DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43088 and AT5G12010

DIOPT Version :10

Sequence 1:NP_001245670.1 Gene:CG43088 / 12797977 FlyBaseID:FBgn0262534 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_196762.1 Gene:AT5G12010 / 831074 AraportID:AT5G12010 Length:502 Species:Arabidopsis thaliana


Alignment Length:71 Identity:17/71 - (23%)
Similarity:28/71 - (39%) Gaps:13/71 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 YDAAW------YR-------FLFATLSFILVSALDGFVMFIYHQECLKLITLKWKSTTVEPSPVN 308
            |:..|      |:       |...::...:||.....|..:|......|..||:.:|.|:||..:
plant    34 YNGIWHCVRSTYKMERVSGFFKGVSMPMSMVSVSSSIVFGVYRNVLRNLCKLKYGTTAVKPSKFD 98

  Fly   309 SLPSGH 314
            ...||:
plant    99 IFLSGY 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43088NP_001245670.1 DDE_Tnp_4 181..330 CDD:463855 17/71 (24%)
AT5G12010NP_196762.1 DDE_Tnp_4 289..447 CDD:463855
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.