DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43088 and AT2G20625

DIOPT Version :10

Sequence 1:NP_001245670.1 Gene:CG43088 / 12797977 FlyBaseID:FBgn0262534 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001324778.1 Gene:AT2G20625 / 816589 AraportID:AT2G20625 Length:190 Species:Arabidopsis thaliana


Alignment Length:36 Identity:8/36 - (22%)
Similarity:17/36 - (47%) Gaps:11/36 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IPLSLRK-----------SMHLKCNTCIFNISDQSF 70
            :|..::|           ||.||.:..||.::.:::
plant   139 LPFEMKKVVVQTREDIESSMKLKASNAIFYMNFKAY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43088NP_001245670.1 DDE_Tnp_4 181..330 CDD:463855
AT2G20625NP_001324778.1 protein_MS5 <140..185 CDD:450408 8/35 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.