DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43206 and UQCR-6.4

DIOPT Version :9

Sequence 1:NP_001246794.1 Gene:CG43206 / 12797919 FlyBaseID:FBgn0262842 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001261057.1 Gene:UQCR-6.4 / 36991 FlyBaseID:FBgn0034245 Length:57 Species:Drosophila melanogaster


Alignment Length:49 Identity:24/49 - (48%)
Similarity:33/49 - (67%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KNQKALAVAFAPSAATFGMAAALAVVYYTDWKVIAGWIPLYNTKFPKPE 66
            |....:|.:|..|.|.||.||.|||:||||||::..::|:|.:||.|.|
  Fly     9 KKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYGSKFEKSE 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43206NP_001246794.1 QCR10 18..59 CDD:305189 19/40 (48%)
UQCR-6.4NP_001261057.1 UCR_6-4kD 7..53 CDD:401083 20/43 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007578
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.