powered by:
Protein Alignment CG43206 and UQCR-6.4
DIOPT Version :9
Sequence 1: | NP_001246794.1 |
Gene: | CG43206 / 12797919 |
FlyBaseID: | FBgn0262842 |
Length: | 72 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001261057.1 |
Gene: | UQCR-6.4 / 36991 |
FlyBaseID: | FBgn0034245 |
Length: | 57 |
Species: | Drosophila melanogaster |
Alignment Length: | 49 |
Identity: | 24/49 - (48%) |
Similarity: | 33/49 - (67%) |
Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 KNQKALAVAFAPSAATFGMAAALAVVYYTDWKVIAGWIPLYNTKFPKPE 66
|....:|.:|..|.|.||.||.|||:||||||::..::|:|.:||.|.|
Fly 9 KKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYGSKFEKSE 57
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0007578 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR15420 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.