DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-6.4L and ucr-11

DIOPT Version :10

Sequence 1:NP_001246794.1 Gene:UQCR-6.4L / 12797919 FlyBaseID:FBgn0262842 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001379967.1 Gene:ucr-11 / 266653 WormBaseID:WBGene00019007 Length:56 Species:Caenorhabditis elegans


Alignment Length:33 Identity:11/33 - (33%)
Similarity:21/33 - (63%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SAATFGMAAALAVVYYTDWKVIAGWIPLYNTKF 62
            |...:|.:|.|..:|:.:||.:..:|||:|.::
 Worm    22 SYGAYGGSAFLLAIYFCEWKTVGQYIPLWNKRY 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-6.4LNP_001246794.1 QCR10 18..59 CDD:474132 10/28 (36%)
ucr-11NP_001379967.1 None

Return to query results.
Submit another query.