DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43206 and ucr-11

DIOPT Version :9

Sequence 1:NP_001246794.1 Gene:CG43206 / 12797919 FlyBaseID:FBgn0262842 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001379967.1 Gene:ucr-11 / 266653 WormBaseID:WBGene00019007 Length:56 Species:Caenorhabditis elegans


Alignment Length:33 Identity:11/33 - (33%)
Similarity:21/33 - (63%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SAATFGMAAALAVVYYTDWKVIAGWIPLYNTKF 62
            |...:|.:|.|..:|:.:||.:..:|||:|.::
 Worm    22 SYGAYGGSAFLLAIYFCEWKTVGQYIPLWNKRY 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43206NP_001246794.1 QCR10 18..59 CDD:305189 10/28 (36%)
ucr-11NP_001379967.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007578
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15420
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.