DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-6.4L and UQCR11

DIOPT Version :10

Sequence 1:NP_001246794.1 Gene:UQCR-6.4L / 12797919 FlyBaseID:FBgn0262842 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_006821.1 Gene:UQCR11 / 10975 HGNCID:30862 Length:56 Species:Homo sapiens


Alignment Length:44 Identity:17/44 - (38%)
Similarity:27/44 - (61%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KALAVAFAPSAATFGMAAALAVVYYTDWKVIAGWIPLYNTKFPK 64
            :.|...:.|:|.|:|...|:.:|:.|||::|..|:|..|.||.|
Human    11 RELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKK 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-6.4LNP_001246794.1 QCR10 18..59 CDD:474132 13/37 (35%)
UQCR11NP_006821.1 UCR_6-4kD 2..52 CDD:462652 14/40 (35%)

Return to query results.
Submit another query.