DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43295 and AT1G71760

DIOPT Version :9

Sequence 1:NP_001246788.1 Gene:CG43295 / 12797916 FlyBaseID:FBgn0262987 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001077810.1 Gene:AT1G71760 / 843506 AraportID:AT1G71760 Length:276 Species:Arabidopsis thaliana


Alignment Length:153 Identity:48/153 - (31%)
Similarity:72/153 - (47%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VQCIQCKMYQVDFVKKAST-WQCKICRQKQSLLKEFFRG-SAAECRVKVQHLNLERGM-QEECLN 69
            :||.:|...||...||:|. |.|.||.||||:.|.|.:| .|.|.|..||..|:.|.: .||...
plant     9 LQCYECSTMQVKQKKKSSNKWVCVICNQKQSVKKVFAQGYKAKELRFFVQSFNMSRKVADEEAHA 73

  Fly    70 TGLFLTAKQQLEEEKDCQEKEENTTPQKKTNKWANYVD-NTIETTQKPAAKPTKTDELSDEISMN 133
            .|   .:..::..|.:..|:...|   ||.:.|:.|:| :::...::.|.:......:::..|..
plant    74 VG---DSFPEVYVEGEVNEEVNGT---KKRSDWSQYLDFDSVNDRRRLAGEEDDVKIVTEMPSNM 132

  Fly   134 FK-----KTRNTGPRSSKRSAEN 151
            ||     |..|.|..||....||
plant   133 FKRPKLNKESNAGGSSSNTGGEN 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43295NP_001246788.1 UPF0544 7..102 CDD:292377 34/96 (35%)
AT1G71760NP_001077810.1 UPF0544 8..100 CDD:292377 34/96 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2591
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146272at2759
OrthoFinder 1 1.000 - - FOG0008397
OrthoInspector 1 1.000 - - oto3461
orthoMCL 1 0.900 - - OOG6_109425
Panther 1 1.100 - - LDO PTHR15863
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.