| Sequence 1: | NP_001246788.1 | Gene: | CG43295 / 12797916 | FlyBaseID: | FBgn0262987 | Length: | 167 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_080819.2 | Gene: | Mrnip / 68067 | MGIID: | 1915317 | Length: | 335 | Species: | Mus musculus |
| Alignment Length: | 232 | Identity: | 56/232 - (24%) |
|---|---|---|---|
| Similarity: | 89/232 - (38%) | Gaps: | 75/232 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 SQQIRVVQCIQCKMYQVDFVKKASTWQCKICRQKQSLLKEFFRGSAAECRVKVQHLNLERGMQEE 66
Fly 67 CLNTGLFLTAKQQLEEEKDCQEKEENTTP-------QKKTNK-----WANYVDNTIETTQKPAAK 119
Fly 120 PTKTDELS---------------------------------DEISMNFKKTRNTGPRSSKRSAEN 151
Fly 152 ------------------MPTVTKKI---CSKWNDFL 167 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43295 | NP_001246788.1 | UPF0544 | 7..102 | CDD:292377 | 35/106 (33%) |
| Mrnip | NP_080819.2 | UPF0544 | 9..107 | CDD:292377 | 35/106 (33%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 75..102 | 8/27 (30%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 118..194 | 8/75 (11%) | |||
| Nuclear localization signal (NLS). /evidence=ECO:0000250|UniProtKB:Q6NTE8 | 145..148 | 0/2 (0%) | |||
| Necessary for the association with the MRN complex. /evidence=ECO:0000250|UniProtKB:Q6NTE8 | 203..230 | 6/24 (25%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 273..335 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2CI02 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0008397 | |
| OrthoInspector | 1 | 1.000 | - | - | oto92658 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_109425 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR15863 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X10262 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.810 | |||||