DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43295 and mrnip

DIOPT Version :9

Sequence 1:NP_001246788.1 Gene:CG43295 / 12797916 FlyBaseID:FBgn0262987 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001296775.1 Gene:mrnip / 641417 ZFINID:ZDB-GENE-051113-228 Length:392 Species:Danio rerio


Alignment Length:187 Identity:60/187 - (32%)
Similarity:93/187 - (49%) Gaps:25/187 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQQIRVVQCIQCKMYQVDFVKKASTWQCKICRQKQSLLKEFFRGSAAECRVKVQHLNLERGMQE 65
            |.|:..|::|..|:.:||..||||..|.||:|.:||||:|||.||:||:||..||.||..||.|.
Zfish     1 MVQEFNVLRCFSCQTFQVQQVKKAKKWTCKVCGEKQSLIKEFGRGAAADCRRHVQKLNALRGEQH 65

  Fly    66 ECLNTGLFLTAKQQLEEEKDCQEKEENTTPQKK--TNKWANYVDNTIE-------------TTQK 115
            : |||...|....:..|.:|..|..:..:.|.:  .::|:.|.|.|.|             .|::
Zfish    66 Q-LNTQQLLAQGDEENENEDVYEVLDPKSEQGEAHVSRWSKYTDQTTEGPNEEEEDEDENVYTER 129

  Fly   116 PAAKPTKTDELSDEISM--------NFKKTRNTGPRSSKRSAENMPTVTKKICSKWN 164
            |..:...|.:.....|:        |::::| :|....::.|.....:.|:..|.||
Zfish   130 PQFRIQGTRKRKKMSSLEPFGGNCDNYEESR-SGYSQFRKQAHLPLQLEKRSSSSWN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43295NP_001246788.1 UPF0544 7..102 CDD:292377 41/96 (43%)
mrnipNP_001296775.1 UPF0544 7..103 CDD:292377 41/96 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8260
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008397
OrthoInspector 1 1.000 - - oto41700
orthoMCL 1 0.900 - - OOG6_109425
Panther 1 1.100 - - LDO PTHR15863
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10262
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.