DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43291 and CG31326

DIOPT Version :10

Sequence 1:NP_001247093.1 Gene:CG43291 / 12797901 FlyBaseID:FBgn0262983 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:139 Identity:33/139 - (23%)
Similarity:59/139 - (42%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLIIWLTLSWIFLSSAQKVYVPYNCCVNYFKYDLVDDGSVYMGIFT---PPSGSNSLYKWSATFD 62
            ::.:.|..|.|.|...|   :|.|.|...|:|....  ..|:|:..   |.:.:.:|.   ..|.
  Fly     6 LVTVLLLASLINLVLGQ---LPRNGCSGRFQYQGYQ--GQYIGLVEVRHPEANNQTLI---LQFS 62

  Fly    63 IHGHSAI--FLSPLMPYPNN---KSNDQRGQVIVYFVN--INSELPMLTHLSLNEHTLCNVTGYG 120
            ..|:...  ::..:....::   :.|.::|..|.|.|:  |.:..|.:|.:.||...||:...|.
  Fly    63 QQGYHDFEDYVGSISLVDDDEVTQENLRQGLPIRYRVDFPIPTIPPKITSMQLNGVQLCSGGVYP 127

  Fly   121 SPSTKITVK 129
            .|.|.||::
  Fly   128 KPRTGITLR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43291NP_001247093.1 GD_N 26..124 CDD:464985 23/107 (21%)
CG31326NP_650344.2 GD_N 26..131 CDD:464985 24/109 (22%)
PHA03378 <101..278 CDD:223065 12/36 (33%)
Tryp_SPc 277..517 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.