DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plk3 and SAK

DIOPT Version :9

Sequence 1:NP_038835.2 Gene:Plk3 / 12795 MGIID:109604 Length:648 Species:Mus musculus
Sequence 2:NP_649324.1 Gene:SAK / 40384 FlyBaseID:FBgn0026371 Length:769 Species:Drosophila melanogaster


Alignment Length:420 Identity:135/420 - (32%)
Similarity:202/420 - (48%) Gaps:60/420 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    51 GRLITDPLSGRTYTKGRLLGKGGFARCYEATDTESGIAYAVKVIPQSRVAKPHQREKILNEIELH 115
            |..|.|      |....||||||||..|:|....:....|:|:|.:..:.......::..|:|:|
  Fly     8 GETIED------YEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIH 66

Mouse   116 RDLQHRHIVRFSHHFEDADNIYIFLELCS----RKSLAHIWKARHTLLEPEVRYYLRQILSGLKY 176
            ..|:|..:::....|:||:.:|:.|||..    .:.:.||  || ...|.|....|:|:::||.|
  Fly    67 SRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHI--AR-PFTETEAASILKQVVAGLLY 128

Mouse   177 LHQRGILHRDLKLGNFFITDNMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPE 241
            ||...|:|||:.|.|..::..|.:|:.|||||.:|:.|::|..|:||||||::|||:.|..||..
  Fly   129 LHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLP 193

Mouse   242 ADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSI 306
            |||||:||::||||.|.|||||..::.|...:....|.:||.||..|:.|:..:|:..|.:|.::
  Fly   194 ADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITL 258

Mouse   307 EQILRHDFFTKGYTPDRLPVSSCVTVPDLTPPNPARSLFAKVTKS------LFGRKKNKNKNHSE 365
            |.:|.|.|..|           |.......|  .|.::|::..:|      .|....::|.....
  Fly   259 EAVLCHPFMLK-----------CSNGGHSAP--GALNVFSQSMESGDSGIITFASSDSRNSQQIR 310

Mouse   366 DQDNVSCLVSGLMRTSIGHPDVRPEAPVVS-----------GQAPASLVETAAEDSSPRGTLASS 419
            ..:|     ||..:..   |.:|.|...|.           |||...|    ||.:.| |...||
  Fly   311 SVEN-----SGPQQVL---PQIREEFKQVHHKLPYEQTGLFGQASTGL----AEPNWP-GAAKSS 362

Mouse   420 GDGFEEGLTVATVVESALCALRNCVAFMPP 449
            ....|.|    .|..|...:|:.....:||
  Fly   363 AFCMEAG----NVPNSKQASLKEDRISVPP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Plk3NP_038835.2 STKc_PLK3 61..315 CDD:271091 99/257 (39%)
S_TKc 63..315 CDD:214567 99/255 (39%)
POLO_box_1 462..550 CDD:240561
POLO_box_2 563..630 CDD:240560
SAKNP_649324.1 STKc_PLK4 12..267 CDD:271088 100/263 (38%)
S_TKc 14..267 CDD:214567 99/255 (39%)
POLO_box_Plk4_1 382..497 CDD:240557 2/7 (29%)
POLO_box_Plk4_2 498..596 CDD:240558
POLO_box_Plk4_3 657..738 CDD:240559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0575
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507604at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.