DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRLB and Dscam1

DIOPT Version :9

Sequence 1:NP_001002901.1 Gene:FCRLB / 127943 HGNCID:26431 Length:426 Species:Homo sapiens
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:409 Identity:76/409 - (18%)
Similarity:126/409 - (30%) Gaps:147/409 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    71 HKKSIEVQTPGVYRCQT---RGAPVSDPIHLSVSNDWLILQVPYAPVF----------EGEPLVL 122
            |..:|:....|.|.|:.   .|:.:|..|.:||       |.|  |.|          .|||.||
  Fly   783 HVDNIQKTNEGYYLCEAINGIG
SGLSAVIMISV-------QAP--PEFTEKLRNQTARRGEPAVL 838

Human   123 RCRGWYDKVVYKL-------------HYYHDGQAVRYFHSSANYTVLQARASDSGRYQCSGTMRI 174
            :|....:|.:..|             :.|...:.:......::.::.:...|||..:.|..|...
  Fly   839 QCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAF 903

Human   175 PVESAPMFSAKVAVTVQELFRAP-VLRVMGPREARGAALGGVVLRCDTRLHPQKRDTPLQFAFYK 238
            ..:     .|.:.:.|||:...| .|:|: .:..|...|...        .|...::||.....:
  Fly   904 GSD-----DASINMIVQEVPEMPYALKVL-DKSGRSVQLSWA--------QPYDGNSPLDRYIIE 954

Human   239 YSRAVRRFDWGAEYTVPEPEVEELESYWCEAATATRSVRKRSPW----LQLPGPGSPLDPASTTA 299
            :.|:  |..|           .|::.......|....|:|.||.    :::....:.....|:.|
  Fly   955 FKRS--RASW-----------SEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEA 1006

Human   300 PAPWAAALAPGNRPLSFRKPPVSRSVPLVT--------------------SVRNTTSTGL----- 339
            .....|..||..:|.:.:..||:::...||                    .:.||.|:.:     
  Fly  1007 VTIITAEEAPSGKPQNIKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETIN 1071

Human   340 ------------------------------------------QFPASGAPTAGP--PACAPPT-- 358
                                                      ||.|.|.|:..|  .||...|  
  Fly  1072 FITEEGKEHNLELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQ 1136

Human   359 ---------PLEQSAGALK 368
                     |||.:.|.:|
  Fly  1137 TIRVGWVSPPLESANGVIK 1155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRLBNP_001002901.1 Ig1_FcgammaR_like 23..100 CDD:143229 8/31 (26%)
Ig2_FcgammaR_like 104..186 CDD:143230 19/104 (18%)
IG_like 114..190 CDD:214653 16/98 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..426
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706 5/20 (25%)
I-set 819..914 CDD:254352 17/99 (17%)
Ig 833..921 CDD:299845 18/92 (20%)
FN3 918..1011 CDD:238020 19/114 (17%)
FN3 1018..1116 CDD:238020 9/97 (9%)
FN3 1124..1217 CDD:238020 9/32 (28%)
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.