DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRLB and si:ch211-165f21.7

DIOPT Version :9

Sequence 1:NP_001002901.1 Gene:FCRLB / 127943 HGNCID:26431 Length:426 Species:Homo sapiens
Sequence 2:XP_021333783.1 Gene:si:ch211-165f21.7 / 100320788 ZFINID:ZDB-GENE-070912-139 Length:386 Species:Danio rerio


Alignment Length:204 Identity:47/204 - (23%)
Similarity:87/204 - (42%) Gaps:38/204 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    16 QAATLEKPILSLHPPWTTIFKGERVTLKCDGYHPLLLELQPISTLWYLGHLLLPS------HK-- 72
            :::|..||::.:.|. ..:|.||.|||.||        :|....:.::|:..:..      |:  
Zfish    51 RSSTRPKPVVKVSPD-QHVFIGETVTLTCD--------IQTGGNIQWIGYSWIKDGDTHNPHRTT 106

Human    73 -------KSIEVQTPGVYRCQ-----TRGAPVSDPIHLSVS--NDWLILQVPYAPVFEGEPLVLR 123
                   :::.....|.|.|:     ::.:.:||.:.|:||  ....:...|.:.||..|.:.|.
Zfish   107 SAAELSFRAVSASVSGQYSCRGERSDSQRSDISDTLTLTVSALPRSRVTVTPDSAVFTEETVNLT 171

Human   124 CRGWYDKVVYKLHYYHDGQAV------RYFHSSANYTVLQARASDSGRYQCSGTMRIPVESAPMF 182
            |....|...:...:|.|..:|      ||..:....|:..|..||.|:|.|.| .|....::...
Zfish   172 CVIESDHSDWTYEWYKDRNSVNLQSDGRYTVNRDTLTIRGAAESDQGQYWCRG-QRSGRPNSSQS 235

Human   183 SAKVAVTVQ 191
            |:.|:::|:
Zfish   236 SSAVSLSVK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRLBNP_001002901.1 Ig1_FcgammaR_like 23..100 CDD:143229 19/96 (20%)
Ig2_FcgammaR_like 104..186 CDD:143230 22/87 (25%)
IG_like 114..190 CDD:214653 22/81 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..426
si:ch211-165f21.7XP_021333783.1 Ig 58..146 CDD:325142 19/96 (20%)
Ig_3 153..223 CDD:316449 18/69 (26%)
Ig_3 265..336 CDD:316449
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9806
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11481
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.