DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRLB and si:dkey-23a13.11

DIOPT Version :9

Sequence 1:NP_001002901.1 Gene:FCRLB / 127943 HGNCID:26431 Length:426 Species:Homo sapiens
Sequence 2:XP_021333780.1 Gene:si:dkey-23a13.11 / 100006263 ZFINID:ZDB-GENE-160113-14 Length:1089 Species:Danio rerio


Alignment Length:286 Identity:74/286 - (25%)
Similarity:107/286 - (37%) Gaps:80/286 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    30 PWTTIFKGERVTLKCDGYHPLLLELQPISTLWY------------LGHLLLPSHKKSI--EVQT- 79
            |...:|.||.|.|.|            :.|.:|            :.||   ||:.|:  ::.| 
Zfish   227 PANPVFTGETVNLTC------------VITTYYSIWRYFWDKDDGVLHL---SHRHSVNRDILTI 276

Human    80 ------PGVYRC--QTRGAPVSDPIHLSVSNDWLILQ---------VPYAPVFEGEPLVLRCRGW 127
                  .|.|.|  :..|..||.....:|   :||::         .|.:.||.||...|:|...
Zfish   277 RAAESDQGQYWCWGEIYGRSVSTQSSTAV---YLIVKASPRSTVTVTPDSAVFTGETFNLKCVIE 338

Human   128 YDKVVYKLHYYHDGQAVRYFHSSANYTVLQ-------ARASDSGRYQCSGTMRIPVESAPMFSAK 185
            .|...:...:|.|...|: ..|..:|||.:       |..||.|:|.|.|.  |...|.......
Zfish   339 SDHSDWTYEWYADRNRVK-LQSDGHYTVNRDTLTIRGAAESDQGQYWCKGF--IDGRSVSTQPTS 400

Human   186 VAVTVQELFRAPVLRVMGPREARGAALGG--VVLRCDTRLHPQKRDTPLQFAFYKYS-----RAV 243
            |.:||::|...|.||    .:..|.||.|  |.|.|:|.|     .|...|.:||.:     :..
Zfish   401 VYLTVKDLKPKPELR----SDPAGPALTGNTVTLTCNTDL-----STGWDFYWYKNTQESEIKTT 456

Human   244 RRFDWGAEYTVPEPEVEELESYWCEA 269
            |.    ..|::....:.:...|||.|
Zfish   457 RT----NSYSMKIDSLSDGGQYWCRA 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRLBNP_001002901.1 Ig1_FcgammaR_like 23..100 CDD:143229 21/92 (23%)
Ig2_FcgammaR_like 104..186 CDD:143230 26/97 (27%)
IG_like 114..190 CDD:214653 24/82 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..426
si:dkey-23a13.11XP_021333780.1 Ig_3 41..115 CDD:316449
IGc2 234..288 CDD:197706 15/68 (22%)
Ig_3 316..386 CDD:316449 20/70 (29%)
IG_like 425..497 CDD:214653 16/63 (25%)
Ig_2 509..601 CDD:316418
Ig_3 610..677 CDD:316449
Ig 785..>847 CDD:325142
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9806
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11481
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.