DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cnbp and CNBP

DIOPT Version :9

Sequence 1:NP_038521.1 Gene:Cnbp / 12785 MGIID:88431 Length:178 Species:Mus musculus
Sequence 2:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster


Alignment Length:182 Identity:70/182 - (38%)
Similarity:90/182 - (49%) Gaps:39/182 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 SNECFKCGRSGHWARECPT------------GGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICY 55
            |..|:||.|.||:||:|..            |||.|.|||....||...:|          :.||
  Fly     4 SATCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNR----------EKCY 58

Mouse    56 RCGESGHLAKDCDLQEDEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKC 120
            :|.:.||.|:.|. :|.|.||.|...|||:|||.:..   ...||.|.|.||..|:|..|..   
  Fly    59 KCNQFGHFARACP-EEAERCYRCNGIGHISKDCTQAD---NPTCYRCNKTGHWVRNCPEAVN--- 116

Mouse   121 YSCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLAREC 172
                     ::..|.|.||:|..|||::.||.:||: .||.||:||||.|||
  Fly   117 ---------ERGPTNVSCYKCNRTGHISKNCPETSK-TCYGCGKSGHLRREC 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CnbpNP_038521.1 PTZ00368 54..172 CDD:173561 48/117 (41%)
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 69/180 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849879
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4609
Isobase 1 0.950 - 0 Normalized mean entropy S1052
OMA 1 1.010 - - QHG53072
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 1 1.000 - - FOG0005222
OrthoInspector 1 1.000 - - otm44047
orthoMCL 1 0.900 - - OOG6_101988
Panther 1 1.100 - - LDO PTHR23002
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4830
SonicParanoid 1 1.000 - - X357
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.750

Return to query results.
Submit another query.