DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clock and cyc

DIOPT Version :9

Sequence 1:NP_001276755.1 Gene:Clock / 12753 MGIID:99698 Length:855 Species:Mus musculus
Sequence 2:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster


Alignment Length:428 Identity:129/428 - (30%)
Similarity:201/428 - (46%) Gaps:82/428 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 CSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVS-----RNKS--EKKRRDQFNVLIKELGSMLP-- 62
            |..|..|.|           |..|::|:.|.|     :|.|  ||:|||:.|..|.||.||:|  
  Fly     7 CENMEEIED-----------ENYDEEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIPMC 60

Mouse    63 -GNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIM 126
             ...||:||.|||:.::..||..:.:.:....:  ..|::|:|||::|...::|:|.:||...:.
  Fly    61 FAMQRKLDKLTVLRMAVQHLRGIRGSGSLHPFN--GSDYRPSFLSDQELKMIILQASEGFLFVVG 123

Mouse   127 TD-GSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILST-------HLLESDSLTPE 183
            .| |.|:|||:||:|:|....:||:.||.|:.:...:..:|.:.||:       .|:::.::.|.
  Fly   124 CDRGRILYVSDSVSSVLNSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLPV 188

Mouse   184 YLKSKNQL---------EFCCHM-LR-----------GTIDPKEPST-----------YEYVRFI 216
            .......|         .|.|.| ||           .|......||           |..::..
  Fly   189 KTDVPQSLCRLCPGARRSFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTGHKYRVIQCT 253

Mouse   217 GNFKSLTSVSTSTHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTV-----EEPNEE- 275
            |..||.|.:.....:. :...|.|:..      |.||..|:  |..::. .||     ..||.. 
  Fly   254 GYLKSWTPIKDEDQDA-DSDEQTTNLS------CLVAIGRI--PPNVRN-STVPASLDNHPNIRH 308

Mouse   276 --FTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQY-GKGKSC 337
              |.||||.|.||||:|.||..:||:||.|:||||.|:|:|.:|:..|.:.|:.:||. .|..:.
  Fly   309 VLFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQ 373

Mouse   338 YYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTV 375
            .|||..|...:|.||:.:....:.|.|..::|:..::|
  Fly   374 VYRFRCKDNSYIQLQSEWRAFKNPWTSEIDYIIAKNSV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClockNP_001276755.1 bHLH-PAS_CLOCK 29..89 CDD:381577 27/69 (39%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:19414601 32..47 7/21 (33%)
PAS 109..>177 CDD:366402 24/75 (32%)
PAS_11 274..377 CDD:373151 42/106 (40%)
Interaction with NR3C1. /evidence=ECO:0000269|PubMed:19141540 371..854 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..411
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..497
Interaction with SIRT1. /evidence=ECO:0000269|PubMed:18662547 450..570
Implicated in the circadian rhythmicity 514..564
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 613..650
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 752..791
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 814..855
cycNP_524168.2 HLH 31..84 CDD:278439 23/52 (44%)
PAS 111..212 CDD:279347 27/100 (27%)
PAS 111..173 CDD:214512 22/61 (36%)
PAS_11 311..411 CDD:291273 41/99 (41%)
PAS 311..406 CDD:238075 40/94 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.