DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clk1 and mnb

DIOPT Version :9

Sequence 1:NP_001036099.1 Gene:Clk1 / 12747 MGIID:107403 Length:483 Species:Mus musculus
Sequence 2:NP_728107.2 Gene:mnb / 32771 FlyBaseID:FBgn0259168 Length:1047 Species:Drosophila melanogaster


Alignment Length:430 Identity:130/430 - (30%)
Similarity:208/430 - (48%) Gaps:69/430 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    85 PGHPYGEPGS----RYQMHSSKSSGRSGRSSY-KSKHRSRHHTSQHHSHGKSHRRKRSRSVEDDE 144
            |.| :.||.|    :..:...|:........| |.|.|::.......|..|..|:..:...:||.
  Fly   225 PNH-FREPASGPLRKLSVDLIKTYKHINEVYYAKKKRRAQQTQGDDDSSNKKERKLYNDGYDDDN 288

Mouse   145 EGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKVGGRRVAVKIVKNVDRYCEAAQSEIQVL 209
            ..::| ::|:....||||...:|:|:||:||:..||: ....||:||:||...:...||.|:::|
  Fly   289 HDYII-KNGEKFLDRYEIDSLIGKGSFGQVVKAYDHE-EQCHVAIKIIKNKKPFLNQAQIEVKLL 351

Mouse   210 EHLNTTDPHSTFRCVQMLEWFEHRGHICIVFELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKS 274
            |.:|..|..:.:..|::...|..|.|:|:|||||..:.||.::..:|....::..||.|.|:|.:
  Fly   352 EMMNRADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTA 416

Mouse   275 VNFLHSNKLT--HTDLKPENILFVKSDYTEAYNPKMKRDERTIVNPDIKVVDFGSATYDDEHHST 337
            :.||.:.:|.  |.||||||||..        |||...         ||:|||||:....:....
  Fly   417 LLFLSTPELNIIHCDLKPENILLC--------NPKRSA---------IKIVDFGSSCQLGQRIYH 464

Mouse   338 LVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMI 402
            .:.:|.||:|||:|.:.:....|:||:||||:|.:.|..:|...:..:.:..:..:||..||:::
  Fly   465 YIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLL 529

Mouse   403 QKTRKRRYFHHDRLDWDEHSSAGRYV------SRRCKPLKEFMLSQDAEHELL------------ 449
            .:..|.|.|      :|:..:.|.||      .|:.||.....|     |::|            
  Fly   530 DQAHKTRKF------FDKIVADGSYVLKKNQNGRKYKPPGSRKL-----HDILGVETGGPGGRRL 583

Mouse   450 -------------FDLIGKMLEYDPAKRITLKEALKHPFF 476
                         .|||.:||::||..|:|...||:|.||
  Fly   584 DEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFF 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Clk1NP_001036099.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Nuclear localization signal. /evidence=ECO:0000255 29..33
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..146 15/65 (23%)
PKc_CLK1_4 147..476 CDD:271115 113/361 (31%)
S_TKc 160..476 CDD:214567 110/348 (32%)
mnbNP_728107.2 PKc_DYRK1 289..628 CDD:271128 115/365 (32%)
S_TKc 303..623 CDD:214567 110/348 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845491
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.