DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AgaP_AGAP003666 and YBR062C

DIOPT Version :9

Sequence 1:	XP_313450.5	Gene:	AgaP_AGAP003666 / 1274343	VectorBaseID:	AGAP003666	Length:	863	Species:	Anopheles gambiae
Sequence 2:	NP_009618.2	Gene:	YBR062C / 852354	SGDID:	S000000266	Length:	180	Species:	Saccharomyces cerevisiae

Alignment Length:	66	Identity:	21/66 - (31%)
Similarity:	32/66 - (48%)	Gaps:	7/66 - (10%)

- Green bases have known domain annotations that are detailed below.

Mosquito   561 SSLPEATTAQLQQFDDVCAICYQDMTS------AKITRCNHYFHGVCLRKWLYVQDRCPLCHEII 619
            :|||.....:|:..|: |:|||.:...      .::..|:|.|...||..||.....||||.:.:
Yeast    93 ASLPRINKKKLKATDN-CSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNV 156

Mosquito   620 M 620
            |
Yeast   157 M 157

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AgaP_AGAP003666	XP_313450.5	TRC8_N	9..547	CDD:290425
		zf-rbx1	<575..616	CDD:289448	15/46 (33%)
		zf-RING_2	576..616	CDD:290367	14/45 (31%)
YBR062C	NP_009618.2	RING_Ubox	109..153	CDD:418438	14/43 (33%)
YBR062C	NP_009618.2	RING-H2 finger (C3H2C3-type)	109..152	CDD:319361	13/42 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910