DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AgaP_AGAP003666 and APC11

DIOPT Version :9

Sequence 1:	XP_313450.5	Gene:	AgaP_AGAP003666 / 1274343	VectorBaseID:	AGAP003666	Length:	863	Species:	Anopheles gambiae
Sequence 2:	NP_010276.3	Gene:	APC11 / 851554	SGDID:	S000002166	Length:	165	Species:	Saccharomyces cerevisiae

Alignment Length:	66	Identity:	20/66 - (30%)
Similarity:	27/66 - (40%)	Gaps:	16/66 - (24%)

- Green bases have known domain annotations that are detailed below.

Mosquito   575 DDVCAIC---YQ----------DMTSAKITRCNHYFHGVCLRKWLYV---QDRCPLCHEIIMNQD 623
            :|||.||   |.          |.....|..|:|.||..|:.:||..   :..||:|.:....|.
Yeast    38 EDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102

Mosquito   624 G 624
            |
Yeast   103 G 103

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AgaP_AGAP003666	XP_313450.5	TRC8_N	9..547	CDD:290425
		zf-rbx1	<575..616	CDD:289448	17/56 (30%)
		zf-RING_2	576..616	CDD:290367	17/55 (31%)
APC11	NP_010276.3	zf-ANAPC11	1..102	CDD:403920	18/63 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910