powered by:
Protein Alignment AgaP_AGAP003666 and APC11
DIOPT Version :9
Sequence 1: | XP_313450.5 |
Gene: | AgaP_AGAP003666 / 1274343 |
VectorBaseID: | AGAP003666 |
Length: | 863 |
Species: | Anopheles gambiae |
Sequence 2: | NP_010276.3 |
Gene: | APC11 / 851554 |
SGDID: | S000002166 |
Length: | 165 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 66 |
Identity: | 20/66 - (30%) |
Similarity: | 27/66 - (40%) |
Gaps: | 16/66 - (24%) |
- Green bases have known domain annotations that are detailed below.
Mosquito 575 DDVCAIC---YQ----------DMTSAKITRCNHYFHGVCLRKWLYV---QDRCPLCHEIIMNQD 623
:|||.|| |. |.....|..|:|.||..|:.:||.. :..||:|.:....|.
Yeast 38 EDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQK 102
Mosquito 624 G 624
|
Yeast 103 G 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.