DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgaP_AGAP010356 and SPAC57A7.09

DIOPT Version :9

Sequence 1:XP_559104.3 Gene:AgaP_AGAP010356 / 1272683 VectorBaseID:AGAP010356 Length:361 Species:Anopheles gambiae
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:239 Identity:59/239 - (24%)
Similarity:116/239 - (48%) Gaps:53/239 - (22%)


- Green bases have known domain annotations that are detailed below.


Mosquito   145 LVRRGSCNFEDKVKHAYERGAAGIIIYNDKNDT--KLEKM----KINDKERNITAVF-TTNAMGR 202
            ||:||.|.:.||...|...|..|:|:.::::.:  :|..|    |:::.:.:|.::| :|::...
pombe   146 LVQRGKCTYFDKALEAQRLGFKGVIVGDNRSPSSFRLHYMVAPDKVDESKVHIPSLFVSTSSYNL 210

Mosquito   203 ELIEILEVHRSVVQMRIIEGSRQFRNLGNINRTSVLFVSISFIVLMIISLVWLVFYYVQRF-RYL 266
            ...::|..:|..:::     ..:...||::....:|..|.|.|:|:.:..:     .:::| |..
pombe   211 LWSDLLHSYRQPLKL-----YAKPEELGDMFWPFLLCFSPSIIMLITVQAL-----AIRKFIRTY 265

Mosquito   267 QTKDKQSKRLCSVAKRIIAKIPTKSIK-----SDDKEIDNDC---------------------CA 305
            :||.|        .:|.|..:|:::|.     |:::||:|..                     |.
pombe   266 RTKSK--------TRRFIEDLPSRTISREGFYSEEEEIENSTQNGELVPLMDESTRRATFGVECV 322

Mosquito   306 ICIEPYKVTDVIRVLPCKHEFHKVCIDPWLLEHR-TCPMCKMDI 348
            ||:|.:...|.:..||||||||:.||..|::::| .||.|..::
pombe   323 ICLESFTKGDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgaP_AGAP010356XP_559104.3 PA_GRAIL_like 76..219 CDD:239037 19/80 (24%)
zf-RING_2 302..345 CDD:290367 19/64 (30%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 59/239 (25%)
Peptidases_S8_S53 <144..211 CDD:299169 17/64 (27%)
zf-RING_2 320..362 CDD:290367 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.