DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgaP_AGAP010356 and hrd1

DIOPT Version :9

Sequence 1:XP_559104.3 Gene:AgaP_AGAP010356 / 1272683 VectorBaseID:AGAP010356 Length:361 Species:Anopheles gambiae
Sequence 2:NP_596376.1 Gene:hrd1 / 2539900 PomBaseID:SPBC17D11.02c Length:677 Species:Schizosaccharomyces pombe


Alignment Length:212 Identity:51/212 - (24%)
Similarity:90/212 - (42%) Gaps:56/212 - (26%)


- Green bases have known domain annotations that are detailed below.


Mosquito   195 FTTNAMGRELIEILEV-HRSVVQMRI-IEGSR------QFRNLGNI--NRTSVLF---VSISFIV 246
            ||:..:|.:...:|.| ..||:.:.: ||.|:      :.|:|..:  .:::.||   |....:.
pombe   160 FTSEHLGDKSTRMLFVCEFSVLLLNLTIEASKLCIYLYEARHLDQVWDEKSTYLFRLEVCRDGLR 224

Mosquito   247 LMIISLVWLV-FYYVQ----RFRYLQT-------KDKQSKRLCSVAKRIIAKIPTKSIKSDDKEI 299
            |:..||:::. |.||.    ..|.:.|       :.::..|.....:.:.|..||    :.::::
pombe   225 LLAYSLLFMYQFPYVSVPIYSIRQMYTCFYSLFRRIREHARFRQATRDMNAMYPT----ATEEQL 285

Mosquito   300 DND--CCAICIE-------PYKVTDVI-----------RVLPCKHEFHKVCIDPWLLEHRTCPMC 344
            .|.  .|.||.|       |.:.||.:           :.|||.|..|..|:..||...:|||:|
pombe   286 TNSDRTCTICREEMFHPDHPPENTDEMEPLPRGLDMTPKRLPCGHILHFHCLRNWLERQQTCPIC 350

Mosquito   345 KMDILKHYGFVVGSSSS 361
            :..       |:|:.||
pombe   351 RRS-------VIGNQSS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgaP_AGAP010356XP_559104.3 PA_GRAIL_like 76..219 CDD:239037 7/24 (29%)
zf-RING_2 302..345 CDD:290367 18/62 (29%)
hrd1NP_596376.1 HRD1 1..514 CDD:227568 51/212 (24%)
zf-RING_2 291..351 CDD:290367 18/59 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.