DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgaP_AGAP010356 and H10E21.5

DIOPT Version :9

Sequence 1:XP_559104.3 Gene:AgaP_AGAP010356 / 1272683 VectorBaseID:AGAP010356 Length:361 Species:Anopheles gambiae
Sequence 2:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans


Alignment Length:127 Identity:78/127 - (61%)
Similarity:103/127 - (81%) Gaps:2/127 - (1%)


- Green bases have known domain annotations that are detailed below.


Mosquito   229 LGNINRTSVLFVSISFIVLMIISLVWLVFYYVQRFRYLQTKDKQSKRLCSVAKRIIAKIPTKSIK 293
            |.:.::|||||||||||:||:|||.||||||||||||...||:..:||.:.|::.:.:|||.:|.
 Worm   152 LRSFSKTSVLFVSISFIILMVISLAWLVFYYVQRFRYAHAKDRLQRRLFNAARKALTRIPTMTIT 216

Mosquito   294 SD-DKEIDNDCCAICIEPYKVTDVIRVLPCKHEFHKVCIDPWLLEHRTCPMCKMDILKHYGF 354
            .. .:|:.:| ||:|::||::.||||:|||||.:||.||||||||||||||||.|||||:|:
 Worm   217 PGMTQELQSD-CAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDILKHFGY 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgaP_AGAP010356XP_559104.3 PA_GRAIL_like 76..219 CDD:239037
zf-RING_2 302..345 CDD:290367 31/42 (74%)
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 78/127 (61%)
RING-H2_GRAIL 226..273 CDD:319582 35/47 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BHU7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22765
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.