DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgaP_AGAP010356 and rnf128

DIOPT Version :9

Sequence 1:XP_559104.3 Gene:AgaP_AGAP010356 / 1272683 VectorBaseID:AGAP010356 Length:361 Species:Anopheles gambiae
Sequence 2:XP_012824820.2 Gene:rnf128 / 100145171 XenbaseID:XB-GENE-877067 Length:403 Species:Xenopus tropicalis


Alignment Length:296 Identity:110/296 - (37%)
Similarity:167/296 - (56%) Gaps:38/296 - (12%)


- Green bases have known domain annotations that are detailed below.


Mosquito    73 AYLNYSFT------GPDGHLIEFGSESAKYGEGRVLNRSGLLVHISNSANH----SDHTGCS--K 125
            |.:|||:.      |.:|.:..||.:|.       :.|:..||.:..|...    .|:|..|  .
 Frog    35 ANVNYSYVYDNRTYGEEGEIGVFGQDSP-------IERAAGLVVLPKSERTFTACKDNTNFSVPH 92

Mosquito   126 QWSGTLGGTIPERDAPWIALV-RRGSCNFEDKVKHAYERGAAGIIIYNDKNDTKLEKMKINDKER 189
            .|:|           |||||: |.|.|.|.:|:..|.||||..:::||:..|.::.:|. :...:
 Frog    93 NWNG-----------PWIALILRGGGCTFTEKINRAAERGARAVVVYNNGMDNEVFEMS-HPGTK 145

Mosquito   190 NITAVFTTNAMGRELIEILEVHRSVVQMRIIEGSRQFRNLGNINRTSVLFVSISFIVLMIISLVW 254
            :..|:...|..|.|::|:::....|  |.:||..|:..:.  ||..|:.|||:||.::...::.:
 Frog   146 DTVAIMIGNIKGNEIVEVIKGGMQV--MMVIEVGRKHGSW--INHYSIFFVSVSFFIVTAATVGY 206

Mosquito   255 LVFYYVQRFRYLQTKDKQSKRLCSVAKRIIAKIPTKSIKSDDKEI--DNDCCAICIEPYKVTDVI 317
            .:||..:|:|..:.::|:.|:|.:.||:.|.|:..::||..||.:  |.|.||:||||||.:||:
 Frog   207 FIFYSARRWRLTRAQNKKMKQLKAEAKKAIGKLQLRTIKQGDKVLGPDGDSCAVCIEPYKPSDVV 271

Mosquito   318 RVLPCKHEFHKVCIDPWLLEHRTCPMCKMDILKHYG 353
            |:|.|.|.|||.||||||||||||||||.||||..|
 Frog   272 RILTCNHFFHKNCIDPWLLEHRTCPMCKCDILKSLG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgaP_AGAP010356XP_559104.3 PA_GRAIL_like 76..219 CDD:239037 43/155 (28%)
zf-RING_2 302..345 CDD:290367 32/42 (76%)
rnf128XP_012824820.2 PA_GRAIL_like 38..174 CDD:239037 43/156 (28%)
COG5540 <208..302 CDD:227827 50/93 (54%)
RING-H2_RNF128_like 256..304 CDD:319716 36/47 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.