DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNTN1 and Cntn1

DIOPT Version :10

Sequence 1:NP_001834.2 Gene:CNTN1 / 1272 HGNCID:2171 Length:1018 Species:Homo sapiens
Sequence 2:NP_031753.1 Gene:Cntn1 / 12805 MGIID:105980 Length:1020 Species:Mus musculus


Alignment Length:1020 Identity:971/1020 - (95%)
Similarity:1001/1020 - (98%) Gaps:2/1020 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGKVSLNC 65
            |||.||||||::||:|:||.:|||:||||||||||||||||||||||||||||||||||||||||
Mouse     1 MKMPLLVSHLLLISLTSCLGDFTWHRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGKVSLNC 65

Human    66 RARASPFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATL 130
            ||||||||||||||||||||||:||||||||||||||||||||||:|||||||||||||||||||
Mouse    66 RARASPFPVYKWRMNNGDVDLTNDRYSMVGGNLVINNPDKQKDAGVYYCLASNNYGMVRSTEATL 130

Human   131 SFGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGN 195
            ||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   131 SFGYLDPFPPEERPEVKVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGN 195

Human   196 LYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQNVT 260
            |||||||:||:||||||||||||||||||||||||||||||||||||||||||||:|.:||||||
Mouse   196 LYIANVESSDRGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDIYTMMGQNVT 260

Human   261 LECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGIYECEAENIRGKDKHQARI 325
            ||||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||||||
Mouse   261 LECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGLYECEAENIRGKDKHQARI 325

Human   326 YVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIPTIRWLKNGYAYHKGELRLYDVTFENAGMYQ 390
            |||||||||||||||||||||||||||:||||||||||||||||:||||||||||||||||||||
Mouse   326 YVQAFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIRWLKNGYSYHKGELRLYDVTFENAGMYQ 390

Human   391 CIAENTYGAIYANAELKILALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWL 455
            |||||.||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   391 CIAENAYGSIYANAELKILALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWL 455

Human   456 VNSSRILIWEDGSLEINNITRNDGGIYTCFAENNRGKANSTGTLVITDPTRIILAPINADITVGE 520
            |||||||||||||||||||||||||||||||||||||||||||||||:|||||||||||||||||
Mouse   456 VNSSRILIWEDGSLEINNITRNDGGIYTCFAENNRGKANSTGTLVITNPTRIILAPINADITVGE 520

Human   521 NATMQCAASFDPALDLTFVWSFNGYVIDFNKE--NIHYQRNFMLDSNGELLIRNAQLKHAGRYTC 583
            ||||||||||||||||||||||||||||||||  :||||||||||:|||||||||||||||||||
Mouse   521 NATMQCAASFDPALDLTFVWSFNGYVIDFNKEITHIHYQRNFMLDANGELLIRNAQLKHAGRYTC 585

Human   584 TAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDD 648
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   586 TAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDD 650

Human   649 WKDAKTDPPIIEGNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIKTDGAAPNVAPSDV 713
            ||||||||||||||||:|:|||||||||||||||||||||.||||||||||||||||||||||||
Mouse   651 WKDAKTDPPIIEGNMESAKAVDLIPWMEYEFRVVATNTLGTGEPSIPSNRIKTDGAAPNVAPSDV 715

Human   714 GGGGGRNRELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMSPST 778
            |||||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||
Mouse   716 GGGGGTNRELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMTPST 780

Human   779 AFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESYQIR 843
            |||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||||||
Mouse   781 AFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWKHVLEKIVESYQIR 845

Human   844 YWAAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFTKKAPPSQP 908
            |||.||||.||:||||||||||||||||||||||||||||||||||||.||:||.||:|||||||
Mouse   846 YWAGHDKEAAAHRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPSSDVIETFTRKAPPSQP 910

Human   909 PRIISSVRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKHSIEVPIPRDGEYV 973
            |||||||||||||||||||||||||||||||||:||||||||||||:||||||||||||||||||
Mouse   911 PRIISSVRSGSRYIITWDHVVALSNESTVTGYKILYRPDGQHDGKLFSTHKHSIEVPIPRDGEYV 975

Human   974 VEVRAHSDGGDGVVSQVKISGAPTLSPSLLGLLLPAFGILVYLEF 1018
            |||||||||||||||||||||..|||.|||.||||:.|.|||.||
Mouse   976 VEVRAHSDGGDGVVSQVKISGVSTLSSSLLSLLLPSLGFLVYSEF 1020

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNTN1NP_001834.2 IgI_1_Contactin-1 40..134 CDD:409436 91/93 (98%)
Ig strand A 42..46 CDD:409436 3/3 (100%)
Ig strand A' 49..54 CDD:409436 4/4 (100%)
Ig strand B 60..68 CDD:409436 7/7 (100%)
Ig strand C 73..79 CDD:409436 5/5 (100%)
Ig strand C' 81..84 CDD:409436 2/2 (100%)
Ig strand D 90..94 CDD:409436 3/3 (100%)
Ig strand E 96..102 CDD:409436 5/5 (100%)
Ig strand F 109..118 CDD:409436 7/8 (88%)
Ig strand G 121..134 CDD:409436 12/12 (100%)
Ig2_Contactin-2-like 142..230 CDD:409392 84/87 (97%)
Ig strand A 144..149 CDD:409392 3/4 (75%)
Ig strand B 153..159 CDD:409392 5/5 (100%)
Ig strand C 168..174 CDD:409392 5/5 (100%)
Ig strand C' 179..181 CDD:409392 1/1 (100%)
Ig strand D 186..191 CDD:409392 4/4 (100%)
Ig strand E 194..198 CDD:409392 3/3 (100%)
Ig strand F 208..216 CDD:409392 7/7 (100%)
Ig strand G 218..230 CDD:409392 11/11 (100%)
IgI_3_Contactin-1 241..328 CDD:143259 82/86 (95%)
Ig strand A 241..246 CDD:143259 4/4 (100%)
Ig strand A' 249..254 CDD:143259 3/4 (75%)
Ig strand B 257..266 CDD:143259 8/8 (100%)
Ig strand C 272..276 CDD:143259 3/3 (100%)
Ig strand C' 279..281 CDD:143259 1/1 (100%)
Ig strand D 289..292 CDD:143259 2/2 (100%)
Ig strand E 293..298 CDD:143259 4/4 (100%)
Ig strand F 306..314 CDD:143259 6/7 (86%)
Ig strand G 317..328 CDD:143259 10/10 (100%)
Ig 332..408 CDD:472250 71/75 (95%)
Ig strand B 348..352 CDD:143205 3/3 (100%)
Ig strand C 361..365 CDD:143205 3/3 (100%)
Ig strand E 374..378 CDD:143205 3/3 (100%)
Ig strand F 388..393 CDD:143205 4/4 (100%)
Ig strand G 401..404 CDD:143205 2/2 (100%)
Ig5_Contactin-1 413..501 CDD:409438 87/87 (100%)
Ig strand A 413..418 CDD:409438 4/4 (100%)
Ig strand A' 421..426 CDD:409438 4/4 (100%)
Ig strand B 430..437 CDD:409438 6/6 (100%)
Ig strand C 445..449 CDD:409438 3/3 (100%)
Ig strand D 463..466 CDD:409438 2/2 (100%)
Ig strand E 467..472 CDD:409438 4/4 (100%)
Ig strand F 480..488 CDD:409438 7/7 (100%)
Ig strand G 494..501 CDD:409438 6/6 (100%)
Ig6_Contactin 503..601 CDD:409359 94/99 (95%)
Ig strand A 503..509 CDD:409359 4/5 (80%)
Ig strand A' 512..517 CDD:409359 4/4 (100%)
Ig strand B 520..528 CDD:409359 7/7 (100%)
Ig strand C 537..541 CDD:409359 3/3 (100%)
Ig strand D 562..565 CDD:409359 2/2 (100%)
Ig strand E 566..570 CDD:409359 3/3 (100%)
Ig strand F 579..586 CDD:409359 6/6 (100%)
Ig strand G 593..597 CDD:409359 3/3 (100%)
FN3 610..697 CDD:238020 83/86 (97%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 693..717 23/23 (100%)
FN3 <745..>945 CDD:442628 189/199 (95%)
fn3 811..893 CDD:394996 77/81 (95%)
FN3 905..989 CDD:238020 81/83 (98%)
Cntn1NP_031753.1 IgI_1_Contactin-1 40..134 CDD:409436 91/93 (98%)
Ig strand A 42..46 CDD:409436 3/3 (100%)
Ig strand A' 49..54 CDD:409436 4/4 (100%)
Ig strand B 60..68 CDD:409436 7/7 (100%)
Ig strand C 73..79 CDD:409436 5/5 (100%)
Ig strand C' 81..84 CDD:409436 2/2 (100%)
Ig strand D 90..94 CDD:409436 3/3 (100%)
Ig strand E 96..102 CDD:409436 5/5 (100%)
Ig strand F 109..118 CDD:409436 7/8 (88%)
Ig strand G 121..134 CDD:409436 12/12 (100%)
Ig2_Contactin-2-like 142..230 CDD:409392 84/87 (97%)
Ig strand A 144..149 CDD:409392 3/4 (75%)
Ig strand B 153..159 CDD:409392 5/5 (100%)
Ig strand C 168..174 CDD:409392 5/5 (100%)
Ig strand C' 179..181 CDD:409392 1/1 (100%)
Ig strand D 186..191 CDD:409392 4/4 (100%)
Ig strand E 194..198 CDD:409392 3/3 (100%)
Ig strand F 208..216 CDD:409392 7/7 (100%)
Ig strand G 218..230 CDD:409392 11/11 (100%)
IgI_3_Contactin-1 241..328 CDD:143259 82/86 (95%)
Ig strand A 241..246 CDD:143259 4/4 (100%)
Ig strand A' 249..254 CDD:143259 3/4 (75%)
Ig strand B 257..266 CDD:143259 8/8 (100%)
Ig strand C 272..276 CDD:143259 3/3 (100%)
Ig strand C' 279..281 CDD:143259 1/1 (100%)
Ig strand D 289..292 CDD:143259 2/2 (100%)
Ig strand E 293..298 CDD:143259 4/4 (100%)
Ig strand F 306..314 CDD:143259 6/7 (86%)
Ig strand G 317..328 CDD:143259 10/10 (100%)
Ig 332..408 CDD:472250 71/75 (95%)
Ig strand B 348..352 CDD:143205 3/3 (100%)
Ig strand C 361..365 CDD:143205 3/3 (100%)
Ig strand E 374..378 CDD:143205 3/3 (100%)
Ig strand F 388..393 CDD:143205 4/4 (100%)
Ig strand G 401..404 CDD:143205 2/2 (100%)
Ig5_Contactin-1 413..501 CDD:409438 87/87 (100%)
Ig strand A 413..418 CDD:409438 4/4 (100%)
Ig strand A' 421..426 CDD:409438 4/4 (100%)
Ig strand B 430..437 CDD:409438 6/6 (100%)
Ig strand C 445..449 CDD:409438 3/3 (100%)
Ig strand D 463..466 CDD:409438 2/2 (100%)
Ig strand E 467..472 CDD:409438 4/4 (100%)
Ig strand F 480..488 CDD:409438 7/7 (100%)
Ig strand G 494..501 CDD:409438 6/6 (100%)
Ig6_Contactin 503..603 CDD:409359 94/99 (95%)
Ig strand A 503..509 CDD:409359 4/5 (80%)
Ig strand A' 512..517 CDD:409359 4/4 (100%)
Ig strand B 520..528 CDD:409359 7/7 (100%)
Ig strand C 537..541 CDD:409359 3/3 (100%)
Ig strand D 564..567 CDD:409359 2/2 (100%)
Ig strand E 568..572 CDD:409359 3/3 (100%)
Ig strand F 581..588 CDD:409359 6/6 (100%)
Ig strand G 595..599 CDD:409359 3/3 (100%)
FN3 612..699 CDD:238020 83/86 (97%)
FN3 650..>947 CDD:442628 282/296 (95%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 695..719 23/23 (100%)
fn3 813..895 CDD:394996 77/81 (95%)
FN3 907..991 CDD:238020 81/83 (98%)

Return to query results.
Submit another query.