DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs1 and Socs16D

DIOPT Version :9

Sequence 1:NP_001258532.1 Gene:Socs1 / 12703 MGIID:1354910 Length:212 Species:Mus musculus
Sequence 2:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster


Alignment Length:239 Identity:67/239 - (28%)
Similarity:107/239 - (44%) Gaps:43/239 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 RNQVAAD-NAISPAAEPRRRSEPSSSSSSSSPAAPVRPRPCPAVPAPA-----------PGDTHF 56
            :.|:|:: |.....||   ..||::.......:..:.|.|..|:|..|           |.:...
  Fly   766 QTQLASELNGTLITAE---ADEPNADLRKKFQSRALPPLPKKALPFTAAAYAIEAVKSEPEEVKT 827

Mouse    57 RTFRSHSDYRRITRTSAL--LDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVK 119
            ...:   :.|.:..||::  :...|:||||||...|.:.|.:||.|:|:||||...:..|:||.|
  Fly   828 NAIQ---EPRALQFTSSIEKVKDYGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFK 889

Mouse   120 MASGPTSIRVHFQAGRFHLDGSRETF--DCLFELLEHYVA-----------------APRRM-LG 164
            :.:....:|:....|.|.. ||...|  ..:.|.:|..|.                 .|.|: |.
  Fly   890 LNNCVRHVRIEQDQGTFSF-GSYAKFKSQTITEFIEKAVEHSRSGRYLFFLHRRPEHGPMRVQLT 953

Mouse   165 APL-RQRRVRPLQELCRQRIVAAVGRENLAR-IPLNPVLRDYLS 206
            .|: |.:.|:.||.:||..|:.||.|::|.: :||...|.|||:
  Fly   954 NPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYLN 997

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs1NP_001258532.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 13/62 (21%)
Kinase inhibitory region (KIR) 56..67 0/10 (0%)
Extended SH2 subdomain (ESS) 68..79 2/12 (17%)
SH2_SOCS1 69..166 CDD:198245 35/118 (30%)
SOCS 170..212 CDD:295349 16/38 (42%)
Interaction with Elongin BC complex 174..183 4/8 (50%)
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 32/98 (33%)
SOCS_SOCS7 960..1009 CDD:239710 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.