DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cish and Socs16D

DIOPT Version :9

Sequence 1:XP_006511698.1 Gene:Cish / 12700 MGIID:103159 Length:325 Species:Mus musculus
Sequence 2:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster


Alignment Length:240 Identity:63/240 - (26%)
Similarity:96/240 - (40%) Gaps:62/240 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   101 AMQPLPTGAFP-----------EEVTEETPVQAENEPKVLDPEGDLLCIAKTFSYLRESGWYWGS 154
            |:.|||..|.|           :...||....|..||:.|.       ...:...:::.|||||.
  Fly   797 ALPPLPKKALPFTAAAYAIEAVKSEPEEVKTNAIQEPRALQ-------FTSSIEKVKDYGWYWGP 854

Mouse   155 ITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRIL 219
            :::..|.:.|...|:|:|:||||:...|:|:||.|......:||||....:|...|....:.:  
  Fly   855 LSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQ-- 917

Mouse   220 AFPDVVSLVQHYVASCAADTRSD--------SPDPAPTPALPMSKQDAPSDSVLPIPVATAVHLK 276
                   .:..::......:||.        .|:..|                        :.::
  Fly   918 -------TITEFIEKAVEHSRSGRYLFFLHRRPEHGP------------------------MRVQ 951

Mouse   277 LVQPFVRRSSARSLQHLCRLVINRLVADVD---CLPLPRRMADYL 318
            |..|..|....:||||:||.||.:.|...|   .||||||:.|||
  Fly   952 LTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYL 996

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CishXP_006511698.1 SH2_CIS 145..232 CDD:198285 25/86 (29%)
SOCS_CIS1 285..325 CDD:239703 19/37 (51%)
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 27/106 (25%)
SOCS_SOCS7 960..1009 CDD:239710 19/37 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.