| Sequence 1: | NP_001832.1 | Gene: | CNR2 / 1269 | HGNCID: | 2160 | Length: | 360 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001024569.1 | Gene: | octr-1 / 184469 | WormBaseID: | WBGene00006411 | Length: | 408 | Species: | Caenorhabditis elegans |
| Alignment Length: | 393 | Identity: | 71/393 - (18%) |
|---|---|---|---|
| Similarity: | 125/393 - (31%) | Gaps: | 147/393 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Human 35 AVAVLCTLLG--LLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVF 97
Human 98 HGVDSKAVFLLKIGSVTM--------------TFTASVGSLLLTAIDRYLCLRYPPSYKALLTRG 148
Human 149 RALVTLGIMWVLSALVSYLPLMGWTCCPRP------CS-------ELFPLIPNDYLLSWLLFIAF 200
Human 201 --LFSGIIYTYGH---------------------------------------------------- 211
Human 212 -----VLWKAHQ------------HVASLSGHQDRQVPGMARMRLDVRLAK-------------- 245
Human 246 -TLGLVLAVLLICWFP-----VLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSG 304
Human 305 EIR 307 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CNR2 | NP_001832.1 | 7tmA_CB2 | 34..310 | CDD:320463 | 71/393 (18%) |
| TM helix 1 | 36..60 | CDD:320463 | 6/25 (24%) | ||
| TM helix 2 | 70..91 | CDD:320463 | 7/20 (35%) | ||
| TM helix 3 | 107..129 | CDD:320463 | 6/35 (17%) | ||
| TM helix 4 | 152..168 | CDD:320463 | 4/15 (27%) | ||
| TM helix 5 | 187..210 | CDD:320463 | 5/24 (21%) | ||
| TM helix 6 | 244..266 | CDD:320463 | 6/41 (15%) | ||
| TM helix 7 | 278..303 | CDD:320463 | 10/24 (42%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 327..360 | ||||
| octr-1 | NP_001024569.1 | 7tmA_alpha2_AR | 22..389 | CDD:320187 | 70/392 (18%) |
| TM helix 1 | 24..48 | CDD:320187 | 5/23 (22%) | ||
| TM helix 2 | 58..80 | CDD:320187 | 7/21 (33%) | ||
| TM helix 3 | 96..118 | CDD:320187 | 3/21 (14%) | ||
| TM helix 4 | 141..157 | CDD:320187 | 4/15 (27%) | ||
| TM helix 5 | 176..199 | CDD:320187 | 4/22 (18%) | ||
| TM helix 6 | 322..347 | CDD:320187 | 5/24 (21%) | ||
| TM helix 7 | 357..382 | CDD:320187 | 10/31 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||