DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNN2 and CG5023

DIOPT Version :10

Sequence 1:NP_001290430.1 Gene:CNN2 / 1265 HGNCID:2156 Length:330 Species:Homo sapiens
Sequence 2:NP_650867.1 Gene:CG5023 / 42400 FlyBaseID:FBgn0038774 Length:169 Species:Drosophila melanogaster


Alignment Length:184 Identity:62/184 - (33%)
Similarity:94/184 - (51%) Gaps:22/184 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    29 QKEAELRTWIEGLTGLSI-GPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFI 92
            ::|.|:..|:..:.|..: ...::..||||..||.|.|||.||||.||.....|:..:||:..|.
  Fly     7 EQEQEVLNWVFAVIGEKVPSGQYEDILKDGIWLCKLANKLAPGSVKKIQERGTNFQLMENIQRFQ 71

Human    93 KAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKGLDLGSLAALCWYSRPLSLTQAKTKGL 157
            .|:..||:...::|:..||||..|:.||.:||.||.                   .:||...:  
  Fly    72 AAVKKYGVPEEEIFQTADLFERRNIPQVTLSLYALG-------------------RITQKHPE-- 115

Human   158 QSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHL 211
            .:|..:|.|.::|.||:|.:..::|.:..:.||||.||.|||:|....|..||:
  Fly   116 YTGPTLGPKMADKNERSFTEEQLRAHEGELNLQMGFNKGASQAGHGGMGNTRHM 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNN2NP_001290430.1 CH_CNN2 27..130 CDD:409132 39/101 (39%)
Calponin 187..211 CDD:459803 12/23 (52%)
Calponin 227..251 CDD:459803
Calponin 266..289 CDD:459803
CG5023NP_650867.1 CH_dMP20-like 4..108 CDD:409056 39/119 (33%)
Calponin 145..169 CDD:459803 12/23 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.