DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF792 and CG31441

DIOPT Version :9

Sequence 1:NP_787068.3 Gene:ZNF792 / 126375 HGNCID:24751 Length:632 Species:Homo sapiens
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:413 Identity:95/413 - (23%)
Similarity:145/413 - (35%) Gaps:139/413 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   125 TLCPQKTCPCDICGLRLKDILHLAEHQTTHPRQKPFVCEAYVKGSEFSANLPRKQVQQNVHNPIR 189
            |..|...|.|  |.::|..||..        |.|   | ..|..|..:||  ||.:::..   |.
  Fly    49 TTLPHLICQC--CKVQLDRILTF--------RNK---C-LEVHKSFMAAN--RKLLRKKA---IV 94

Human   190 TEEGQASPVKTCR----DHTSDQLSTCREGGKDFVATAGFLQCEVTPSDGEPHEATEGVVDFHIA 250
            .||.....|:..:    |||..::...      ...|||.|:        |.|...|        
  Fly    95 DEELDKPDVEKLQQDLWDHTDQEMCVA------MADTAGLLR--------EDHNDNE-------- 137

Human   251 LRHNKCCESGDAFNNKSTLVQHQRIHSRERPYECSKCGIFFTYAADLTQH--QKVHNRGKPYECC 313
                |..::.||..|:....:..::.:.|                  .:|  :::||.       
  Fly   138 ----KAKDAEDATQNEKNQEEQVQVQTEE------------------VEHCQEQLHNM------- 173

Human   314 ECGKFFSQHSSLVKHRRVHTGESPHVCGDCGKFFSRSSNLIQHKRVHTGEKPYECSDC-GKFFSQ 377
               ...|:..|....:|.........|..||..|..|:.|..|.:.|:|.||:.|..| .|:::.
  Fly   174 ---SIISKGVSARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTD 235

Human   378 RSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTGERPYKCNECGKFFSHIASLIQHQI 442
                                                           ||          :.:|:|
  Fly   236 -----------------------------------------------NE----------MRRHRI 243

Human   443 VHTGERPHGCGECGKAFSRSSDLMKHQRVHTGERPYECNECGKLFSQSSSLNSHRRLHTGERPYQ 507
            :||..||:.|..|.|.:...|..:.|:|.||.|||::|..|.|.|:.:|:...|..|||.:|.|.
  Fly   244 LHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYH 308

Human   508 CSECGKFFNQSSSLNNHR--RLH 528
            |..|.::|.:||.|..|:  :||
  Fly   309 CEICDQWFLRSSHLTLHQSTKLH 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF792NP_787068.3 KRAB 14..74 CDD:214630
KRAB 14..53 CDD:279668
C2H2 Zn finger 256..276 CDD:275368 3/19 (16%)
C2H2 Zn finger 284..304 CDD:275368 1/21 (5%)
C2H2 Zn finger 312..332 CDD:275368 3/19 (16%)
zf-H2C2_2 324..349 CDD:290200 6/24 (25%)
C2H2 Zn finger 340..360 CDD:275368 7/19 (37%)
COG5048 <348..592 CDD:227381 49/184 (27%)
zf-H2C2_2 352..377 CDD:290200 9/25 (36%)
C2H2 Zn finger 368..388 CDD:275368 3/20 (15%)
C2H2 Zn finger 396..416 CDD:275368 0/19 (0%)
C2H2 Zn finger 424..444 CDD:275368 4/19 (21%)
C2H2 Zn finger 452..472 CDD:275368 6/19 (32%)
zf-H2C2_2 464..489 CDD:290200 11/24 (46%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
zf-H2C2_2 492..517 CDD:290200 9/24 (38%)
C2H2 Zn finger 508..528 CDD:275368 7/21 (33%)
zf-H2C2_2 520..545 CDD:290200 4/11 (36%)
C2H2 Zn finger 536..556 CDD:275368
zf-H2C2_2 548..573 CDD:290200
C2H2 Zn finger 564..584 CDD:275368
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 13/46 (28%)
COG5048 <174..337 CDD:227381 56/215 (26%)
C2H2 Zn finger 197..217 CDD:275370 7/19 (37%)
C2H2 Zn finger 225..245 CDD:275368 7/76 (9%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 268..290 CDD:290200 11/21 (52%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 309..328 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.