DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment OR1I1 and ser-7

DIOPT Version :9

Sequence 1:	NP_001004713.1	Gene:	OR1I1 / 126370	HGNCID:	8207	Length:	355	Species:	Homo sapiens
Sequence 2:	NP_741730.1	Gene:	ser-7 / 180565	WormBaseID:	WBGene00004780	Length:	435	Species:	Caenorhabditis elegans

Alignment Length:	141	Identity:	35/141 - (24%)
Similarity:	61/141 - (43%)	Gaps:	14/141 - (9%)

- Green bases have known domain annotations that are detailed below.

Human    24 QTLLFTMFLSTYLVTIIGNALIILAIITDSHLHTPMYFFLFNLSLVDTLLSSTTVPKMLANIQAQ 88
            :.||....|:..::|.:||||:.||::....|..|..|.|.:|::.|..:....:|  ||.|...
Worm    41 KALLAIAILAMIIMTTVGNALVCLAVLLVRKLKHPQNFLLVSLAVADFFVGLVVMP--LALIDLL 103

Human    89 SRAIPFVGCLTQMYAFHLFGTMDSFL-------LAVMAIDRFVAIVHPQRYLVLMCSPVCGLLLG 146
            ....|....:..:|.     |.|..|       |..:::||::.|..|.||.....:....:.:.
Worm   104 FDKWPLGSTMCSVYT-----TSDLTLCTASIVNLCAISVDRYLVISSPLRYSAKRTTKRIMMYIA 163

Human   147 ASWMITNLQSL 157
            ..|:|..:.|:
Worm   164 CVWIIAAIVSI 174

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
OR1I1	NP_001004713.1	7tm_4	31..305	CDD:304433	33/134 (25%)
OR1I1	NP_001004713.1	7tm_1	41..290	CDD:278431	31/124 (25%)
ser-7	NP_741730.1	7tmA_5-HT7	42..382	CDD:320452	35/140 (25%)
		TM helix 1	44..68	CDD:320452	9/23 (39%)
		TM helix 2	77..99	CDD:320452	6/23 (26%)
		TM helix 3	115..137	CDD:320452	5/26 (19%)
		TM helix 4	160..176	CDD:320452	3/15 (20%)
		TM helix 5	201..224	CDD:320452
		TM helix 6	315..340	CDD:320452
		TM helix 7	350..375	CDD:320452
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910