DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cflar and Decay

DIOPT Version :9

Sequence 1:NP_001276633.1 Gene:Cflar / 12633 MGIID:1336166 Length:481 Species:Mus musculus
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:234 Identity:60/234 - (25%)
Similarity:94/234 - (40%) Gaps:25/234 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse   243 EETYRMQSKPLGICLII---DCIG--------NDTKYLQETFTSLGYHIQLF---LFPKSHDITQ 293
            |:||...:: .||.||:   |..|        .|...::.|....|:.::.|   .|.:.:|..:
  Fly    46 EDTYENCAR-AGIALILNHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLK 109

Mouse   294 IVRRYASMAQHQDYDSFACVLVSLGGSQSMMGRDQVHSGFSLDHVKNMFTGDTCPSLRGKPKLFF 358
            .|.|    ..|...|.|...::|.|....:..:|.   .:.::.:.|.|.||.|.:|:.||||||
  Fly   110 EVAR----EDHSQNDCFVLAVMSHGTEGKVYAKDM---SYPVERLWNPFLGDNCKTLKNKPKLFF 167

Mouse   359 IQ--NYESLGSQLEDSSLEVDGPSIKNVDSKPLQPRHCTTHPEADIFWSLCTADVSHLEKPSSSS 421
            ||  ...:|...:|.||..|....:....:..:||........|||.....|.|.....:.....
  Fly   168 IQACRGANLEKAVEFSSFAVMTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDG 232

Mouse   422 SVYLQKLSQQLKQGRRRPLVDLH-VELMDKVYAWNSGVS 459
            |.::|.|.:.|.|.......... |||:..:.|.|..|:
  Fly   233 SWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CflarNP_001276633.1 Interaction with CASP8 propeptide. /evidence=ECO:0000250|UniProtKB:O15519 6..307 18/77 (23%)
Interaction with FADD. /evidence=ECO:0000250|UniProtKB:O15519 6..229
Interaction with CASP8. /evidence=ECO:0000250|UniProtKB:O15519 6..200
DED_c-FLIP_r1 6..85 CDD:260044
DED_c-FLIP_r2 96..176 CDD:260046
Interaction with TRAF1 and TRAF2. /evidence=ECO:0000250|UniProtKB:O15519 197..481 60/234 (26%)
Interaction with CASP3. /evidence=ECO:0000250|UniProtKB:O15519 197..436 54/208 (26%)
Interaction with CASP8 subunits p18 and p10. /evidence=ECO:0000250|UniProtKB:O15519 219..481 60/234 (26%)
CASc 246..480 CDD:214521 58/231 (25%)
Caspase 265..360 26/97 (27%)
Interaction with CASP8. /evidence=ECO:0000250|UniProtKB:O15519 372..481 21/89 (24%)
DecayNP_477462.1 CASc 54..302 CDD:237997 57/226 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.