DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLK3 and SAK

DIOPT Version :9

Sequence 1:NP_004064.2 Gene:PLK3 / 1263 HGNCID:2154 Length:646 Species:Homo sapiens
Sequence 2:NP_649324.1 Gene:SAK / 40384 FlyBaseID:FBgn0026371 Length:769 Species:Drosophila melanogaster


Alignment Length:554 Identity:148/554 - (26%)
Similarity:226/554 - (40%) Gaps:160/554 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    50 GRLITDPRSGRTYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELH 114
            |..|.|      |....||||||||..|:|....|....|:|:|.:..:.......::..|:|:|
  Fly     8 GETIED------YEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIH 66

Human   115 RDLQHRHIVRFSHHFEDADNIYIFLELCS----RKSLAHIWKARHTLLEPEVRYYLRQILSGLKY 175
            ..|:|..:::....|:||:.:|:.|||..    .:.:.||  || ...|.|....|:|:::||.|
  Fly    67 SRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHI--AR-PFTETEAASILKQVVAGLLY 128

Human   176 LHQRGILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPE 240
            ||...|:|||:.|.|..::..|.:|:.|||||.:|:.|::|..|:||||||::|||:.|..||..
  Fly   129 LHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLP 193

Human   241 ADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSI 305
            |||||:||::||||.|.|||||..::.|...:....|.:||.||..|:.|:..:|:..|.:|.::
  Fly   194 ADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITL 258

Human   306 DQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKSKNHAQERDEVSG 370
            :.:|.|.|..|           |        .|...|  |....::|.:..:|.:        ||
  Fly   259 EAVLCHPFMLK-----------C--------SNGGHS--APGALNVFSQSMESGD--------SG 294

Human   371 LVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDGFEEGLTVATVVESAL 435
            :::.....|...|..|                 :.|:|.|:..|....:.|::       |...|
  Fly   295 IITFASSDSRNSQQIR-----------------SVENSGPQQVLPQIREEFKQ-------VHHKL 335

Human   436 CALRNCIAFMPPAEQN------PAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFNDGTH 494
                       |.||.      ...||:|       .|                           
  Fly   336 -----------PYEQTGLFGQASTGLAEP-------NW--------------------------- 355

Human   495 MALSANRKTVHYNPTSTKH--FSFSVGAVPRALQPQLGILRYFASYMEQHLMKGGDLPSVEEVEV 557
                         |.:.|.  |....|.||.:.|                       .|::|..:
  Fly   356 -------------PGAAKSSAFCMEAGNVPNSKQ-----------------------ASLKEDRI 384

Human   558 PAPP-----LLLQWVKTDQALLMLFSDGTVQVNF 586
            ..||     ||....||..|::.:..:|.|.:.|
  Fly   385 SVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEF 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLK3NP_004064.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
STKc_PLK3 60..314 CDD:271091 99/257 (39%)
S_TKc 62..314 CDD:214567 99/255 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..417 6/35 (17%)
POLO_box_1 460..548 CDD:240561 8/89 (9%)
POLO_box_2 561..628 CDD:240560 9/31 (29%)
SAKNP_649324.1 STKc_PLK4 12..267 CDD:271088 100/263 (38%)
S_TKc 14..267 CDD:214567 99/255 (39%)
POLO_box_Plk4_1 382..497 CDD:240557 10/37 (27%)
POLO_box_Plk4_2 498..596 CDD:240558
POLO_box_Plk4_3 657..738 CDD:240559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0575
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507604at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.