DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNGA4 and CG42260

DIOPT Version :9

Sequence 1:XP_016872706.1 Gene:CNGA4 / 1262 HGNCID:2152 Length:577 Species:Homo sapiens
Sequence 2:NP_001356969.1 Gene:CG42260 / 37614 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster


Alignment Length:472 Identity:195/472 - (41%)
Similarity:294/472 - (62%) Gaps:8/472 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     8 KTTESSPPAPSKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPDLQHGYLVAWLVL 72
            :|......|.:.||||..|.||:|...|:|...:....:||..:::.|..|.::....:..|..|
  Fly   554 RTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCL 618

Human    73 DYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRISSRYVRTWSFFLDLASLMPTDVVYVRLGPHTP 137
            ||.||.|||:|::..|.||:||.|:|..|..::.:.|:.:..|::|...|:|.|.:|:.:| ...
  Fly   619 DYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIG-FNS 682

Human   138 TLRLNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWV 202
            .||..|.::..|.:...||||..|.|||.||...|:.|:.|:.|||.|||..:.:..|||...||
  Fly   683 ILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWV 747

Human   203 YPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAREEEYLFMVGDFLLAVMGFATIMGSMSS 267
            |.|.....   :.:|||.|:|:.||.|||:||.|.|..:.||:|::...|..:|.|||::|.:::
  Fly   748 YHDSESAD---VVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVAN 809

Human   268 VIYNMNTADAAFYPDHALVKKYMKLQHVNRKLERRVIDWYQHLQINKKMTNEVAILQHLPERLRA 332
            ::.:::.|...|......||.||:::.|...|:.:||.|:.:|.:.:|.::|...:..||::|:|
  Fly   810 IVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKA 874

Human   333 EVAVSVHLSTLSRVQIFQNCEASLLEELVLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLAVVA 397
            |:|::|||.||.||:||||.||..|.||||:|:|..:|||:|:||||::|:||||:..|:|.|||
  Fly   875 EIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVA 939

Human   398 DDGITQYAVLGAGLYFGEISIINIKATGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQA 462
            |:|.|..|.|.||.|||||||:|:    ..:||||||:::|:||||||.|||:|:.:||.|||.|
  Fly   940 DNGKTVMASLKAGSYFGEISILNM----GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAA 1000

Human   463 QTIMEEKGREILLKMNK 479
            :..:|....:.|.|..|
  Fly  1001 RVRLESIAVKRLEKYKK 1017

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNGA4XP_016872706.1 None
CG42260NP_001356969.1 Ion_trans 581..819 CDD:334124 86/241 (36%)
CAP_ED 890..1004 CDD:237999 69/117 (59%)
DUF4655 1084..>1154 CDD:317882
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1073751at2759
OrthoFinder 1 1.000 - - FOG0000167
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100817
Panther 1 1.100 - - O PTHR45638
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.