DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cenpb and cag

DIOPT Version :9

Sequence 1:NP_031708.2 Gene:Cenpb / 12616 MGIID:88376 Length:599 Species:Mus musculus
Sequence 2:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster


Alignment Length:134 Identity:47/134 - (35%)
Similarity:81/134 - (60%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 RRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTN 69
            |..||..||..:||..|.| .|...::|:||||..:..:.|||:|::|     |.|:.|...|.|
  Fly    10 RTSLTLEEKMEVIQSQERN-KLSVRDLAKRFNIGKTQAADILKHKQSI-----KEGLLSGELKLN 68

Mouse    70 KL--SPYD----KLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRR 128
            ::  :|..    :::.:...||.::|...:|:.|.::::||.::|.|||..:|:||:|||:::|:
  Fly    69 QMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRK 133

Mouse   129 RHGV 132
            ||.|
  Fly   134 RHNV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenpbNP_031708.2 CENP-B_N 2..56 CDD:282122 20/50 (40%)
CENPB 74..135 CDD:197828 21/63 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..183
DDE_1 222..384 CDD:281213
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 394..476
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..543
Homodimerization. /evidence=ECO:0000250 536..599
CENP-B_dimeris <539..598 CDD:286159
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 21/55 (38%)
CENPB 78..141 CDD:197828 21/60 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10787
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm42505
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.