DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cenpa and cid

DIOPT Version :9

Sequence 1:XP_011239001.1 Gene:Cenpa / 12615 MGIID:88375 Length:146 Species:Mus musculus
Sequence 2:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster


Alignment Length:145 Identity:50/145 - (34%)
Similarity:67/145 - (46%) Gaps:22/145 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 RKPQTPRRRPSSPAPGPSRQSSSVGLRIERRALCVQGSQTLRR-------RQKFMWLKEIKTLQK 62
            |.|||  ||.:......:|.:..|..:          :||.||       |.|.| .:||:.||.
  Fly    91 RSPQT--RRMTVQQESKTRAAGPVAAQ----------NQTRRRKAANPMSRAKRM-DREIRRLQH 142

Mouse    63 STDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAYLLSLHAGRVTL 127
            ....|..|.|||.:|||...|:|..........||||:||:.|.:|.....|:|:|:.|..||||
  Fly   143 HPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTL 207

Mouse   128 FPKDIQLTRRI--RG 140
            ..:|:.|...|  ||
  Fly   208 EVRDMALMAYICDRG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenpaXP_011239001.1 H3 41..143 CDD:128705 42/109 (39%)
cidNP_523730.2 H4 135..219 CDD:419976 32/83 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.