DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cel and CG4382

DIOPT Version :9

Sequence 1:NP_034015.1 Gene:Cel / 12613 MGIID:88374 Length:599 Species:Mus musculus
Sequence 2:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster


Alignment Length:581 Identity:176/581 - (30%)
Similarity:259/581 - (44%) Gaps:116/581 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse    35 GVNKKLSLL-----------------GGDSVDIFKGIPFATAKT----LENPQRHPGWQGTLKAT 78
            |.||:||.|                 .|.:...|:|||:|....    .:.|:....|..||.||
  Fly    36 GSNKELSDLVITTALGKIRGTILPSQSGRNFYAFRGIPYAKPPVDRLRFQPPEPVEQWFDTLDAT 100

Mouse    79 NFKKRCLQATITQDNTYGQEDCLYLNIWVPQ--GRKQVSHNLPVMVWIYGGAFLMGSGQGANFLK 141
            ....:|.|..:...:.  .||||.:||:..:  ...|.:...||:|:|:.|.|...|||..||. 
  Fly   101 FDGPKCPQLGLVSGDV--SEDCLRVNIYTKELPSESQPNVRRPVIVFIHPGGFYSLSGQSKNFA- 162

Mouse   142 NYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLRDQHMAIAWVKRNIAAFGGDPD 206
                 |.:......:::||||||:|.||||:||....|||.||:||...:.|||.:|:.|||||.
  Fly   163 -----GPQYFMNRRLVLVTFNYRLGSLGFLATGTREAPGNMGLKDQVQLLRWVKLHISRFGGDPS 222

Mouse   207 NITIFGESAGAASVSLQTLSPYNKGLIRRAISQSGMALSPWAIQKNPLFWAKTIAKKVGCPTEDT 271
            :||:.|..|||.:|:|..:||.::||..:||..||.....|::..:.:..|...|..:.|.||:.
  Fly   223 SITLLGYGAGAMAVTLHMVSPMSRGLFHKAIVMSGAVTGQWSLPDHQMDVATKQATLLHCHTENV 287

Mouse   272 GKMAACLKITDPRALTLAYKLPVKKQEY----PVVHYLAFIPVIDGD-----FIPDDPINLYNNT 327
            .:|..|||  ....|..|..|| |..|:    |::   .:.|||:.|     |:.::||..|.|.
  Fly   288 TEMMDCLK--GKHYLEFANTLP-KMFEFDRNNPLI---LWKPVIEPDFGQERFLVEEPIRSYQND 346

Mouse   328 --ADIDYIAGINNMD--GHLFATIDVPAVDKTKQTVTEEDFYRLVSGHTVAKGLKGAQATFDIYT 388
              ..:..|.|:...:  |...:.:..|    |..:...|:|..|.             ..|.:|.
  Fly   347 DFMKVPIITGMTKDEFVGPALSILQSP----TLLSALNENFESLA-------------PVFFMYN 394

Mouse   389 ESWAQ--DPSQE-----------NMKKTVVAFE---TDVL--FLIPTEIALAQHKAHAKSAKTYS 435
            .|.|:  :.|||           :..:::.|..   :|.|  |.|...:.||     |:|.|.|.
  Fly   395 TSDARACNISQELRNHYFPDKLIDANRSLEALSNLYSDALTGFGIHRFVHLA-----ARSTKVYY 454

Mouse   436 YLFSHP-SRMPIY-----PKWMGADHADDLQYVFGKPFATPLGYRPQD--RAVSKAMIAYWTNFA 492
            |.||:. :|..||     |  .|..|.|||.|:|.:|..:.:.....|  |.|. .|:..::.||
  Fly   455 YRFSYQGARSHIYYPEDAP--YGVVHHDDLMYLFVEPSISRMFTEDDDEFRMVD-IMVRMFSAFA 516

Mouse   493 RSGDPNMGNSPVPT-------HWYPYTLENGNYLDITKTITSASMKEHLREKFLKFWAVTF 546
            ..||||.     ||       .|.|::.:...||||.|.||   ::|:|..:..:.|...|
  Fly   517 YKGDPNK-----PTDLALRDIRWRPFSFKKRYYLDIGKHIT---LEENLNAENYEIWKRLF 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CelNP_034015.1 COesterase 26..542 CDD:278561 174/575 (30%)
Aes <117..>247 CDD:223730 57/129 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..599
4 X 11 AA tandem repeats, O-glycosylated region 559..588
CG4382NP_609301.2 COesterase 41..565 CDD:278561 171/570 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.