DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CEACAM20 and ceacam19ly

DIOPT Version :9

Sequence 1:XP_011524731.1 Gene:CEACAM20 / 125931 HGNCID:24879 Length:623 Species:Homo sapiens
Sequence 2:XP_004912060.1 Gene:ceacam19ly / 101730899 XenbaseID:XB-GENE-22169421 Length:307 Species:Xenopus tropicalis


Alignment Length:323 Identity:65/323 - (20%)
Similarity:105/323 - (32%) Gaps:123/323 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   236 SHTTRTFTIHAVSREH--EGLYRCLVSNSATHLSSLGTLKVRVLETLTMPQVVPSSLNLVENARS 298
            :|.....::|.....|  :|:|..::....  :..| |:.:.|.|.:|.|.:..||.:...| .:
 Frog    84 AHGLPNGSLHISDLAHTDQGMYTVMILTGG--MERL-TVHLPV
YEPVTKPVIRCSSPHPKVN-ET 144

Human   299 VDLTCQTVNQSVNVQWFLSGQPLLPSEHLQLSADNRTLIIHGLQRNDTGPYACEVWNWGSRARSE 363
            :.|.|:|.|.. .:.|...... ||| ...||.||||:.:|.:..:|||.|.||..|..||:.|:
 Frog   145 ISLICETANWE-RISWSKDSSS-LPS-RADLSPDNRTVTLHNITFSDTGQYQCEAKNTVSRSVSD 206

Human   364 PLELTINYGPDQVHITRESASEMISTIEAELNSSLTLQCWAESKPGAEYRWTLEHSTGEHLGEQL 428
            ...|.:||  ::.|:.                                                 
 Frog   207 IFTLVVN
Y--NEPHMD------------------------------------------------- 220

Human   429 IIRALTWEHDGIYNCTASNSLTGLARSTSVLVKVVGPQSSSLSSGAIAGIVIGILAVIAVASELG 493
                         ||.||                        .:|.|.|.:.||..:|...    
 Frog   221 -------------NCAAS------------------------MAGIICGTIAGIALIICTT---- 244

Human   494 YFLCIRNARRPSRKTTEDPSHE---------------TSQPIPKE------EHPTEPSSESLS 535
             ||..:....|.|:..::...|               .:||..:|      |:||:.:...|:
 Frog   245 -FLLYKKYILPKREVQKEQPTEGQDSYRIYYNVYAATMAQPAKEELPYMGLEYPTQDTYSELT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CEACAM20XP_011524731.1 Ig 96..183 CDD:299845
IG_like 97..170 CDD:214653
Ig_2 202..274 CDD:290606 7/39 (18%)
IG_like 202..274 CDD:214653 7/39 (18%)
Ig 293..370 CDD:299845 27/76 (36%)
IG_like 388..460 CDD:214653 4/71 (6%)
Ig_2 396..462 CDD:290606 4/65 (6%)
C_Hendra 499..>554 CDD:293426 10/58 (17%)
ceacam19lyXP_004912060.1 Ig_CEACAM_like 32..123 CDD:319302 7/41 (17%)
Ig 125..213 CDD:386229 32/91 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D241176at32523
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.