DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdx4 and cad

DIOPT Version :9

Sequence 1:NP_031700.1 Gene:Cdx4 / 12592 MGIID:88362 Length:282 Species:Mus musculus
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:259 Identity:95/259 - (36%)
Similarity:121/259 - (46%) Gaps:71/259 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 AGMYPGTLRSPGGSSTAGVGTSGGSGSPLPASNFTAAPVYPHYVGYPHMSNMDPHGPSLGAWSSP 75
            :|..||..:....:|:.|||.:||.|.                ||          |.:.|...| 
  Fly   128 SGGAPGAPQLNETNSSIGVGGAGGGGG----------------VG----------GATDGGPGS- 165

Mouse    76 YSPPREDWSTYPGPPSTMGTVPMNDMTSPVFGSPDYSTLGP--------------TSGASNGGSL 126
             :||........|.||...||..::::||  |:|. |...|              .:..:|..:.
  Fly   166 -APPNHQQHIAEGLPSPPITVSGSEISSP--GAPT-SASSPHHHLAHHLSAVANNNNNNNNNNNS 226

Mouse   127 PDAASESLVSLDSGTSGATSPSRSRHSPY-AWMRK----------------------TVQVTGKT 168
            |...:.:..:.....:..||||:   .|| .||:|                      .:..:|||
  Fly   227 PSTHNNNNNNNSVSNNNRTSPSK---PPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKT 288

Mouse   169 RTKEKYRVVYTDHQRLELEKEFHCNRYITIRRKSELAVNLGLSERQVKIWFQNRRAKERKMIKK 232
            |||:||||||||.||||||||:..:||||||||||||..|.|||||||||||||||||||..||
  Fly   289 RTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdx4NP_031700.1 Caudal_act 13..160 CDD:309740 37/161 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..36 8/22 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..156 14/72 (19%)
Homeobox 175..227 CDD:306543 43/51 (84%)
cadNP_001260641.1 Homeobox 295..347 CDD:278475 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7058
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4534
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - otm42881
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24332
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2707
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.950

Return to query results.
Submit another query.