DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdx1 and cad

DIOPT Version :9

Sequence 1:NP_034010.3 Gene:Cdx1 / 12590 MGIID:88360 Length:268 Species:Mus musculus
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:236 Identity:91/236 - (38%)
Similarity:107/236 - (45%) Gaps:81/236 - (34%)


- Green bases have known domain annotations that are detailed below.


Mouse    24 GLGPPTYAPPGPAPAPPQYPDFAGYTHV-EPAPAPPPTWAAPFPAPKDDWAAAYGPGPTASAASP 87
            |:|..|  ..||..|||.:..     |: |..|:||.|.:.         :....||...||:||
  Fly   154 GVGGAT--DGGPGSAPPNHQQ-----HIAEGLPSPPITVSG---------SEISSPGAPTSASSP 202

Mouse    88 APLAFGPPPDFSPVPAPPGPGPGILAQSLGA-----------PGAPSSPG--------------A 127
                                 ...||..|.|           ..:||:..              :
  Fly   203 ---------------------HHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTS 246

Mouse   128 PRRTPY-EWMRRSVAAAGG-----------------GGSGKTRTKDKYRVVYTDHQRLELEKEFH 174
            |.:.|| :||::....|..                 ..||||||||||||||||.||||||||:.
  Fly   247 PSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYC 311

Mouse   175 YSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK 215
            .|||||||||||||..|.|:|||||||||||||||||.|||
  Fly   312 TSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdx1NP_034010.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..152 35/171 (20%)
Caudal_act 13..138 CDD:282574 31/140 (22%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P47902 157..178 16/20 (80%)
Homeobox 158..210 CDD:278475 43/51 (84%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:P47902 196..207 10/10 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..268 6/7 (86%)
cadNP_001260641.1 Homeobox 295..347 CDD:278475 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7058
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4534
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - otm42881
orthoMCL 1 0.900 - - OOG6_107786
Panther 1 1.100 - - LDO PTHR24332
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2707
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.