DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdkn1c and dap

DIOPT Version :9

Sequence 1:XP_006508530.1 Gene:Cdkn1c / 12577 MGIID:104564 Length:360 Species:Mus musculus
Sequence 2:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster


Alignment Length:124 Identity:32/124 - (25%)
Similarity:46/124 - (37%) Gaps:26/124 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse    16 RLASSDTFPVIARSSAC--------RSLFGPVDHEE-------LGRELRMRLAELNAEDQNRWDF 65
            :::||   |.::|:.||        |.|||.....|       ...||. |..||..:   :|.|
  Fly    17 KMSSS---PAVSRNLACGRQLNRIKRDLFGSSKSAEGTANKTPFNSELE-RHQELATQ---KWGF 74

Mouse    66 NFQQDVPLRGPGRLQWMEV---DSESVPAFYRETVQVGRCRLQLGPRPPPVAVAVIPRS 121
            :|:...||.......|..|   :|...|..|..| :....|......|..:.:.|..||
  Fly    75 DFRAGCPLAEKSPYIWERVSFQESSFAPEMYTLT-RAAHVRPSADASPSDMDILVNERS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdkn1cXP_006508530.1 CDI 34..81 CDD:366992 14/53 (26%)
PTZ00341 <197..281 CDD:173534
dapNP_476948.1 CDI 41..83 CDD:280409 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4743
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10265
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.