DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and CG6800

DIOPT Version :9

Sequence 1:NP_034004.2 Gene:Cdk7 / 12572 MGIID:102956 Length:346 Species:Mus musculus
Sequence 2:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster


Alignment Length:283 Identity:110/283 - (38%)
Similarity:169/283 - (59%) Gaps:8/283 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 RYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNII 75
            ||:.|:.:|||....|:||.|...|:.|||||:.|.::.   ..|....|||||.||......|:
  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKF---GNIALNTLREIKTLQLCKSEYIL 69

Mouse    76 GLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKP 140
            .::|.:...:.:|||.::....|...:|.....|:...::.:.....:|:.|||:..::|||:||
  Fly    70 DIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKP 134

Mouse   141 NNLLLDENGVLKLADFGLAKSF--GSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCIL 203
            .|||:.:..:||:||||||:.:  ...:|.|:.||.||||||||:|||::.||.||||||.||::
  Fly   135 ANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVV 199

Mouse   204 AELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDY--VTFKSFPGVPLQHIFIAAGD 266
            ||:|..||...|.:|::||..|..|||:|...|||::.|||||  :.|.:..|:...::|.:...
  Fly   200 AEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTH 264

Mouse   267 DL-LELIQGLFLFNPCTRTTASQ 288
            .: :.|:..|.::||..|..||:
  Fly   265 AVEINLVSNLVVYNPKNRLKASE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_034004.2 PTZ00024 7..308 CDD:240233 110/283 (39%)
STKc_CDK7 11..308 CDD:270833 110/283 (39%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 110/283 (39%)
S_TKc 9..288 CDD:214567 109/282 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.