DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk6 and Cdk4

DIOPT Version :9

Sequence 1:NP_034003.1 Gene:Cdk6 / 12571 MGIID:1277162 Length:326 Species:Mus musculus
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster


Alignment Length:308 Identity:137/308 - (44%)
Similarity:206/308 - (66%) Gaps:8/308 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MEKDSLSRADQ-------QYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLST 58
            :::..:|:|.:       .|:.:..|||||||.|::|||:.. |..||||:||:..:|.|:|:||
  Fly     7 LKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVIT-GNIVALKKVRISLNENGVPMST 70

Mouse    59 IREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIK 123
            :||:::|:.|....|.|:|:|::||.....|.:..:.||||||:|||:..:|::|:.|:...||:
  Fly    71 LREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQ 135

Mouse   124 DMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAP 188
            .:..:||.|:|||||||::||||||||:||:|.|.:|:||||||:.|..:|.|||||||||||||
  Fly   136 RLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKLTSVVVTLWYRAP 200

Mouse   189 EVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGEEDWPRDVALPRQA 253
            ||||...|.:.||:||..||..|||.|:.||.|:|:.:||.:|.::.|.|.|:.||:.:::..:.
  Fly   201 EVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEH 265

Mouse   254 FHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQ 301
            |..:..:..:.|...:.:...|||.|.|:::...|.||...|.|.|||
  Fly   266 FPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk6NP_034003.1 STKc_CDK6 11..300 CDD:270846 132/295 (45%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 132/286 (46%)
S_TKc 26..312 CDD:214567 132/286 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 279 1.000 Domainoid score I1684
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H963
Inparanoid 1 1.050 280 1.000 Inparanoid score I2886
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004605
OrthoInspector 1 1.000 - - otm43552
orthoMCL 1 0.900 - - OOG6_108285
Panther 1 1.100 - - LDO PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2222
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.820

Return to query results.
Submit another query.