DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and Eip63E

DIOPT Version :9

Sequence 1:NP_034000.1 Gene:Cdk4 / 12567 MGIID:88357 Length:303 Species:Mus musculus
Sequence 2:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster


Alignment Length:313 Identity:123/313 - (39%)
Similarity:166/313 - (53%) Gaps:48/313 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 AATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAF 66
            |..:.||   :|.|:|.||||.....:...||||.:|:..    ..|.|.:.:||.:||:.|   
  Fly   204 AYVKLEP---LGEGSYATVYKGFSKLTYQRVALKEIRLQE----EEGAPFTAIREASLLKEL--- 258

Mouse    67 EHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFL 131
            :|.|:|.|.|:..|..|     :|.|||:::.||..|::| .|.||....::..:.|.|.||.:.
  Fly   259 KHSNIVTLHDIVHTRET-----LTFVFEYVNTDLSQYMEK-HPGGLDHRNVRLFLFQLLRGLSYC 317

Mouse   132 HANCIVHRDLKPENILVTSNGTVKLADFGLAR-------IYSYQMALTPVVVTLWYRAPEVLLQS 189
            |...::|||:||:|:|::..|.:|||||||||       .||::      |||||||.|:|||.|
  Fly   318 HKRRVLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHE------VVTLWYRPPDVLLGS 376

Mouse   190 T-YATPVDMWSVGCIFAEMFRRKPLFCGNSEA-DQLGKIFDLIGLPPEDDWPREVSLP------R 246
            | |:|.:|||.|||||.||....|.|.|..:. |||.|||.|:|.|.||.||.....|      .
  Fly   377 TEYSTSLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKPHKL 441

Mouse   247 GAFAPRG-----PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSY 294
            |.:.||.     ||....:..|...:|      .|..||.:|:.|..||||.|
  Fly   442 GFYRPRKLGHNFPRLYDIIEGETIANG------FLQLNPEQRLGADDALQHPY 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_034000.1 STKc_CDK4 5..295 CDD:143368 122/310 (39%)
Required for binding D-type cyclins. /evidence=ECO:0000250 50..56 1/5 (20%)
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 123/313 (39%)
STKc_PCTAIRE_like 204..489 CDD:270835 123/313 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.