DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and CG6800

DIOPT Version :9

Sequence 1:NP_904326.1 Gene:Cdk2 / 12566 MGIID:104772 Length:346 Species:Mus musculus
Sequence 2:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster


Alignment Length:331 Identity:104/331 - (31%)
Similarity:160/331 - (48%) Gaps:63/331 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 FQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLD 68
            ::.:||||||.:|.|:||.:....:.||:||:.|..:...:....:|||..|:......|:.::|
  Fly     9 YKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDIID 73

Mouse    69 VIHTENKLYLVFEF----LHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLK 129
            :......|.||.|:    |:..||     |.:..:....::.:..|:.:|:|:.|...::|||:|
  Fly    74 IYPDLTGLSLVLEYQPDTLYNRLK-----SEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIK 133

Mouse   130 PQNLLINAEGSIKLADFGLARAFGVP---VRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGC 191
            |.||||:....:|:|||||||.: .|   .|.|:.:|.|.||||||||.|.:.|.|.||:|:.||
  Fly   134 PANLLISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGC 197

Mouse   192 IFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVSAPHPVTRRALFPGDSE 256
            :.|||                                       :..|         .||.|.::
  Fly   198 VVAEM---------------------------------------LRGV---------PLFAGTTD 214

Mouse   257 IDQLFRIFRTLGTPDEVVWPGVTSMPDY-KPSFPKWARQDFSKVVPPLDEDGR-SLLSQMLHYDP 319
            |:||..|.||||:|....||.:||:||| |..||......:..:.|....... :|:|.::.|:|
  Fly   215 IEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHAVEINLVSNLVVYNP 279

Mouse   320 NKRISA 325
            ..|:.|
  Fly   280 KNRLKA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_904326.1 STKc_CDK2_3 3..334 CDD:270844 104/331 (31%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 104/331 (31%)
S_TKc 9..288 CDD:214567 104/331 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.