DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Eip63E

DIOPT Version :9

Sequence 1:NP_904326.1 Gene:Cdk2 / 12566 MGIID:104772 Length:346 Species:Mus musculus
Sequence 2:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster


Alignment Length:349 Identity:151/349 - (43%)
Similarity:201/349 - (57%) Gaps:58/349 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 ENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKL 66
            |.:.|:|.:|||:|..|||..:|||.:.||||:|||. |.||.|.|||||.||||||.|.|||.|
  Fly   203 EAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQ-EEEGAPFTAIREASLLKELKHSNIVTL 266

Mouse    67 LDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQ 131
            .|::||...|..|||:::.||.::|:... .|:....::.:|||||:||::||..||||||:|||
  Fly   267 HDIVHTRETLTFVFEYVNTDLSQYMEKHP-GGLDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQ 330

Mouse   132 NLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEM 196
            ||||:..|.:||||||||||..||..||:|||||||||.|::|||...|||::|:|.:||||.||
  Fly   331 NLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEM 395

Mouse   197 HLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVSAPHPVTRRALFPGDSE-IDQL 260
                                                            ||....|||..: .|||
  Fly   396 ------------------------------------------------VTGMPTFPGIRDTYDQL 412

Mouse   261 FRIFRTLGTPDEVVWPGVTSMPDYKP---SF--PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPN 320
            .:||:.||||.|..|||||..|.|||   .|  |:....:|.::...:  :|.::.:..|..:|.
  Fly   413 DKIFKLLGTPTEDTWPGVTHFPGYKPHKLGFYRPRKLGHNFPRLYDII--EGETIANGFLQLNPE 475

Mouse   321 KRISAKAALAHPFFQDVTKPVPHL 344
            :|:.|..||.||:|..:.|.:..|
  Fly   476 QRLGADDALQHPYFAQLPKKLYEL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_904326.1 STKc_CDK2_3 3..334 CDD:270844 147/336 (44%)
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 149/340 (44%)
STKc_PCTAIRE_like 204..489 CDD:270835 147/336 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.