DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk2 and Cdk4

DIOPT Version :9

Sequence 1:NP_904326.1 Gene:Cdk2 / 12566 MGIID:104772 Length:346 Species:Mus musculus
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster


Alignment Length:346 Identity:144/346 - (41%)
Similarity:188/346 - (54%) Gaps:70/346 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 NFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKEL---NHPNIV 64
            |:|::..||||.||.||:|::.:||.:|||||:|:.....|||.:.:|||||||:|   ||.|||
  Fly    25 NYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIV 89

Mouse    65 KLLDV---IHTENKL--YLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVL 124
            ||.:|   :..:.:|  .||||.:.|||...:|....:|:..|.|:....:||.|:.|.||||::
  Fly    90 KLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRII 154

Mouse   125 HRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSL 189
            ||||||||||::::|.:|:||||||:.:|..:: .|..||||||||||:||...|.|| |||||.
  Fly   155 HRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMK-LTSVVVTLWYRAPEVLLAQPYNST-VDIWSA 217

Mouse   190 GCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVSAPHPVTRRALFPGD 254
            .||..||                                                ..|||||||.
  Fly   218 ACIIFEM------------------------------------------------FNRRALFPGT 234

Mouse   255 SEIDQLFRIFRTLGTPDEVVWPGVTSM-----PDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQM 314
            ||.:||.|||...|.|.|..||...|:     |...|..||    ||   .|.|.:....||::|
  Fly   235 SEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPK----DF---CPHLCKYADDLLNKM 292

Mouse   315 LHYDPNKRISAKAALAHPFFQ 335
            |.||.:.|.||.|.|.|.:||
  Fly   293 LSYDLHLRPSALACLEHDYFQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk2NP_904326.1 STKc_CDK2_3 3..334 CDD:270844 142/343 (41%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 141/342 (41%)
S_TKc 26..312 CDD:214567 141/342 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.