DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdh8 and CadN

DIOPT Version :9

Sequence 1:NP_031693.2 Gene:Cdh8 / 12564 MGIID:107434 Length:799 Species:Mus musculus
Sequence 2:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster


Alignment Length:573 Identity:176/573 - (30%)
Similarity:294/573 - (51%) Gaps:66/573 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    94 KKIKYILSGDG------AGTIFQINDITGDIHAIKRLDREE---KAEYTLTAQAVDFETNKPLEP 149
            :.|.|.|:|.|      |.:.|.||..||:|..:|.|||::   :.::..|..|.| |..:.|..
  Fly  1553 QNIVYFLTGQGIDPDNPANSKFDINRTTGEIFVLKPLDRDQPNGRPQWRFTVFAQD-EGGEGLVG 1616

Mouse   150 PSEFIIKVQDINDNAPEFLNGPYHATVPEMSILGTSVTNVTATDADDPVYGNSAKLVYSILE--- 211
            .::..:.::|||||||.|..|.|...|.|....|..|..:||.|.|||..|::|:|||||.:   
  Fly  1617 YADVQVNLKDINDN
APIFPQGVYFGNVTENGTAGMVVMTMTAVDYDDPNEGSNARLVYSIEKNVI 1681

Mouse   212 ----GQPYFSIEPETAIIKTALPNMDREAKEEYLVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDN 272
                |.|.|.|||:|.:||||:..:|||...:|.:.:.|.|    .|||.||.|.::.:.|:||.
  Fly  1682 EEETGSPIFEIEPDTGVIKTAVCCLDRERTPDYSIQVVAMD----GGGLKGTGTASIRVKDINDM 1742

Mouse   273 PPKFAQSLYHFSVPEDVVLGTAIGR-----VKANDQDIGENAQSSYDIIDGDGTALFEITSDAQA 332
            ||:|.:..:...|  |...|||:..     |..:|:|  |..:..|.:||..|....:.|. .:.
  Fly  1743 PPQFTKDEWFTEV--DETDGTALPEMPILTVTVHDED--ETNKFQYKVIDNSGYGADKFTM-VRN 1802

Mouse   333 QDGV--IRLRKPLDFETKKSYTLKVEAANIHIDPRFSSRGPFKDT-------ATVKIVVEDA-DE 387
            .||.  :::.:|||:|.      ::::.......:.:.:|...|.       :.|.:.:.|. |.
  Fly  1803 NDGTGSLKIVQPLDYED------QLQSNGFRFRIQVNDKGEDNDNDKYHVAYSWVVVKLRDINDN 1861

Mouse   388 PPVFSSPTYLLEVHENAALNSVIGQVTARDPDI-TSSPIRFSIDRHTDLERQFNINADDGKITLA 451
            .|.|......:.|.|:..:.:.:.:..|.|||. ..|.:.:||||.:|.:|||.|| .:|.:|:.
  Fly  1862 KPHFERANVEVSVFEDTKVGTELEKFKATDPDQGGKSKVSYSIDRSSDRQRQFAIN-QNGSVTIQ 1925

Mouse   452 TPLDRELSVWHNITIIATEIRNHSQISRVPVAIKVLDVNDNAPEFASEYEAFLCENGKPGQVIQT 516
            ..||||:...|.:.|:|.:..:..:.:...:.:.|.|:|||||:|..:|...|.|:..|.:|::.
  Fly  1926 RSLDREVVPRHQVKILAIDDGSPPKTATATLTVIVQDINDNAPKFLKDYRPVLPEHVPPRKVVEI 1990

Mouse   517 VSAMDKDDPK-NGHFFLYSLLP--EMVNNPNFTIKKNE----DNSLSILAKHNGFNRQKQEVYLL 574
            ::..|.|..| ||..|.:.|.|  :.:...:|.:::::    .:.:::::....|:|::|:.|::
  Fly  1991 LATDDDDRSKSNGPPFQFRLDPSADDIIRASFKVEQDQKGANGDGMAVISSLRSFDREQQKEYMI 2055

Mouse   575 PIVISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYV---------LPIG 618
            ||||.|.|:|.::.|||||: :.|..||..:|..:.:.:|         .|||
  Fly  2056 PIVIKDHGSPAMTGTSTLTV-IIGDVNDNKMQPGSKDIFVYNYQGQSPDTPIG 2107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdh8NP_031693.2 CA 87..165 CDD:214520 26/79 (33%)
Cadherin_repeat 171..272 CDD:206637 43/107 (40%)
Cadherin_repeat 281..387 CDD:206637 24/120 (20%)
Cadherin_repeat 395..492 CDD:206637 29/97 (30%)
Cadherin_repeat 499..602 CDD:206637 31/109 (28%)
Cadherin_C 645..790 CDD:366437
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637
Cadherin_repeat 765..853 CDD:206637
Cadherin_repeat 862..964 CDD:206637
Cadherin_repeat 973..1074 CDD:206637
Cadherin_repeat 1083..1166 CDD:206637
Cadherin_repeat <1219..1298 CDD:206637
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637
Cadherin_repeat 1522..1630 CDD:206637 24/77 (31%)
Cadherin_repeat 1638..1741 CDD:206637 42/106 (40%)
Cadherin_repeat 1762..1861 CDD:206637 20/107 (19%)
Cadherin_repeat 1871..1966 CDD:206637 29/95 (31%)
Cadherin_repeat 1974..2083 CDD:206637 32/109 (29%)
EGF 2350..2380 CDD:278437
LamG 2385..2570 CDD:238058
EGF_2 <2605..2631 CDD:285248
Laminin_G_2 2665..2800 CDD:280389
EGF_CA 2869..2907 CDD:238011
Cadherin_C 2952..3088 CDD:279398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5176
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.