DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdh15 and CadN

DIOPT Version :9

Sequence 1:NP_031688.2 Gene:Cdh15 / 12555 MGIID:106672 Length:784 Species:Mus musculus
Sequence 2:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster


Alignment Length:828 Identity:219/828 - (26%)
Similarity:331/828 - (39%) Gaps:236/828 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    49 PPI---------SVSENHKRLPYPLVQIKS---DKQQLGSVIYSIQGPGVD-EEPRN-VFSIDKF 99
            ||:         ...|:.:.||..::|:.:   ||.:..:::|.:.|.|:| :.|.| .|.|::.
  Fly  1515 PPVFERPTYRTQITEEDDRNLPKRVLQVTATDGDKDRPQNIVYFLTGQGIDPDNPANSKFDINRT 1579

Mouse   100 TGRVYLNATLDREKTD---RFRLRAFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQDVFRGRIL 161
            ||.:::...|||::.:   ::|...||.|.||..|....|:::.:.|.|||.|.|.|.|:.|.:.
  Fly  1580 TGEIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADVQVNLKDINDNAPIFPQGVYFGNVT 1644

Mouse   162 EGAIPGTFVTRAEATDADDP-ETDNAALRFSI------LEQGSPEFFSIDEHTGEIRTVQVGLDR 219
            |....|..|....|.|.||| |..||.|.:||      .|.||| .|.|:..||.|:|....|||
  Fly  1645 ENGTAGMVVMTMTAVDYDDPNEGSNARLVYSIEKNVIEEETGSP-IFEIEPDTGVIKTAVCCLDR 1708

Mouse   220 EVVAVYNLTLQVADMSGDGLTATASAIISIDDINDNAPEFTKDEFFMEAAEAVSGVDVGRLEVED 284
            |....|  ::||..|.|.||..|.:|.|.:.||||..|:|||||:|.|       ||    |.:.
  Fly  1709 ERTPDY--SIQVVAMDGGGLKGTGTASIRVKDINDMPPQFTKDEWFTE-------VD----ETDG 1760

Mouse   285 KDLPGSPNWVARFTILEGDPDGQFKI------------YTDPKTNEGV--LSVVKPLDYESREQ- 334
            ..||..|  :...|:.:.|...:|:.            :|..:.|:|.  |.:|:|||||.:.| 
  Fly  1761 TALPEMP--ILTVTVHDEDETNKFQYKVIDNSGYGADKFTMVRNNDGTGSLKIVQPLDYEDQLQS 1823

Mouse   335 --YELRVSVQNEAPLQAAAPRARRGQTR-----------VSVWVQDTNE-APVFPENPLRTSIAE 385
              :..|:.|.:            :|:..           |.|.::|.|: .|.|....:..|:.|
  Fly  1824 NGFRFRIQVND------------KGEDNDNDKYHVAYSWVVVKLRDINDNKPHFERANVEVSVFE 1876

Mouse   386 GAPPGTSVATFSARDPDTEQLQRISYSKDYDPEDWLQ-VDGATGRIQTQRVLS----PASPFLKD 445
            ....||.:..|.|.|||.....::|||.|...:...| .....|.:..||.|.    |.      
  Fly  1877 DTKVGTELEKFKATDPDQGGKSKVSYSIDRSSDRQRQFAINQNGSVTIQRSLDREVVPR------ 1935

Mouse   446 GWYRAIILALDNAIPPSTATGTLSIEILEVNDHAPALALPPSGSLCSEPDQGPG---LLLGATDE 507
              ::..|||:|:..||.|||.||::.:.::||:||.........|   |:..|.   :.:.|||:
  Fly  1936 --HQVKILAIDDGSPPKTATATLTVIVQDINDNAPKFLKDYRPVL---PEHVPPRKVVEILATDD 1995

Mouse   508 D--LPPHGAPFHFQLNPRVPDLGR-NWSVSQIN----------VSHARLRLRHQVSEGLHRLSLL 559
            |  ...:|.||.|:|:|...|:.| ::.|.|..          :|..|...|.|..|  :.:.::
  Fly  1996 DDRSKSNGPPFQFRLDPSADDIIRASFKVEQDQKGANGDGMAVISSLRSFDREQQKE--YMIPIV 2058

Mouse   560 LQDSGEPPQQREQTLNVTVCRCG--SDGTCLPGAAALRGGGVGVSLGALVIVLASTVVLLVLILL 622
            ::|.|.|......||.|.:   |  :|....||:                               
  Fly  2059 IKDHGSPAMTGTSTLTVII---GDVNDNKMQPGS------------------------------- 2089

Mouse   623 AALRTRFRGHSRGKSLLHGLQEDLRDNILNYDEQGGGEE---------DQDAYDI-------NQL 671
                                     .:|..|:.||...:         |.|.:|:       ..:
  Fly  2090 -------------------------KDIFVYNYQGQSPDTPIGRVYVYDLDDWDLPDKKFYWEAM 2129

Mouse   672 RHP----------VEPRATSRSLGRPPLRRDAPFSYVPQPHRVLPTSPSDI-ANFISDGLEAADS 725
            .||          |..||.:|. ||..||    |....:.|     :.:|| ||......|.   
  Fly  2130 EHPRFKLDEDSGMVTMRAGTRE-GRYHLR----FKVYDRKH-----TQTDIPANVTVTVREI--- 2181

Mouse   726 DPSVPPYDTALIYDYEGDGSVAGTLSSILSSLGDEDQDYDYLRDWGPR 773
                 |::..:     ..|||.      ||.:.||    |::|.|..|
  Fly  2182 -----PHEAVV-----NSGSVR------LSGISDE----DFIRVWNYR 2209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdh15NP_031688.2 Cadherin_repeat 51..147 CDD:206637 29/112 (26%)
Cadherin_repeat 155..255 CDD:206637 43/106 (41%)
Cadherin 270..366 CDD:278457 25/123 (20%)
Cadherin_repeat 378..478 CDD:206637 31/104 (30%)
Cadherin 486..579 CDD:278457 28/108 (26%)
Cadherin_C 639..782 CDD:279398 36/162 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 676..700 8/23 (35%)
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637
Cadherin_repeat 765..853 CDD:206637
Cadherin_repeat 862..964 CDD:206637
Cadherin_repeat 973..1074 CDD:206637
Cadherin_repeat 1083..1166 CDD:206637
Cadherin_repeat <1219..1298 CDD:206637
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637
Cadherin_repeat 1522..1630 CDD:206637 29/107 (27%)
Cadherin_repeat 1638..1741 CDD:206637 42/105 (40%)
Cadherin_repeat 1762..1861 CDD:206637 24/112 (21%)
Cadherin_repeat 1871..1966 CDD:206637 31/102 (30%)
Cadherin_repeat 1974..2083 CDD:206637 29/116 (25%)
EGF 2350..2380 CDD:278437
LamG 2385..2570 CDD:238058
EGF_2 <2605..2631 CDD:285248
Laminin_G_2 2665..2800 CDD:280389
EGF_CA 2869..2907 CDD:238011
Cadherin_C 2952..3088 CDD:279398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8035
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.