DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CG6800

DIOPT Version :9

Sequence 1:NP_031685.2 Gene:Cdk1 / 12534 MGIID:88351 Length:297 Species:Mus musculus
Sequence 2:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster


Alignment Length:291 Identity:108/291 - (37%)
Similarity:164/291 - (56%) Gaps:23/291 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MEDYI-----KIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRH 60
            ||||.     .:||||||.:|.|:|.......:.||:||:.|:::...:....:|||..|:..:.
  Fly     1 MEDYAPSRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKS 65

Mouse    61 PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDS-IPPGQFMDSSLVKSYLHQILQGIVFCHSRRV 124
            ..|:.:.|:....:.|.|:.|:....|...|.| :.|   :....|:.:.||:.:||.:.|...:
  Fly    66 EYILDIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNP---LSRQQVRKFAHQMFKGIAYLHEAGL 127

Mouse   125 LHRDLKPQNLLIDDKGTIKLADFGLARAFGIP---IRVYTHEVVTLWYRSPEVLLGSARYSTPVD 186
            :|||:||.||||.|...:|:|||||||.: .|   .|:|:.:|.|.|||:||:|.||.:|.|.||
  Fly   128 MHRDIKPANLLISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVD 191

Mouse   187 IWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDY-KNTFPKWKPGSLA 250
            :|:.|.:.||:....|||.|.::|:||..|.|.||:|....|||:.||.|| |..|    |.|:.
  Fly   192 MWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRF----PNSVG 252

Mouse   251 SHVKNLDEN-----GLDLLSKMLVYDPAKRI 276
            .|..||..:     .::|:|.::||:|..|:
  Fly   253 IHWDNLFPSCTHAVEINLVSNLVVYNPKNRL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_031685.2 PLN00009 1..293 CDD:177649 108/291 (37%)
STKc_CDK1_euk 3..287 CDD:270845 106/289 (37%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 104/284 (37%)
S_TKc 9..288 CDD:214567 104/283 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.