DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and Cdk7

DIOPT Version :9

Sequence 1:NP_031685.2 Gene:Cdk1 / 12534 MGIID:88351 Length:297 Species:Mus musculus
Sequence 2:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster


Alignment Length:292 Identity:127/292 - (43%)
Similarity:182/292 - (62%) Gaps:12/292 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 EDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEE---EGVPSTAIREISLLKELRHPNI 63
            |.|.|:..:|||.:..|||.|..||.||||:|||:..|.|   :|:..||:|||.:|:||:|.||
  Fly    10 ERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHENI 74

Mouse    64 VSLQDVLMQDSRLYLIFEFLSMDLKKYL--DSIPPGQFMDSSLVKSYLHQILQGIVFCHSRRVLH 126
            :.|.||..|.|.:.|:|:|:..||:..:  :.|    .:..:.:|:|....|:|:.:.|...:||
  Fly    75 IGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKI----ILTQANIKAYAIMTLKGLEYLHLNWILH 135

Mouse   127 RDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIG 191
            |||||.|||::..|.:|:.|||||::||.|.|:|||.|||.||||||:|.|:.:|.|.||:|::|
  Fly   136 RDLKPNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVG 200

Mouse   192 TIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNL 256
            .|.|||..:.|...|||::|||.|||..||||....||.:..|.||.. |..: ||:...::...
  Fly   201 CILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDYLQ-FRNF-PGTPLDNIFTA 263

Mouse   257 DENGL-DLLSKMLVYDPAKRISGKMALKHPYF 287
            ..|.| .|:.::...:|.:|:|.:.||..|||
  Fly   264 AGNDLIHLMQRLFAMNPLRRVSCREALSMPYF 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_031685.2 PLN00009 1..293 CDD:177649 127/292 (43%)
STKc_CDK1_euk 3..287 CDD:270845 124/289 (43%)
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 127/292 (43%)
STKc_CDK7 11..308 CDD:270833 126/291 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.