DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd9 and Tsp42Er

DIOPT Version :9

Sequence 1:NP_031683.1 Gene:Cd9 / 12527 MGIID:88348 Length:226 Species:Mus musculus
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:147 Identity:39/147 - (26%)
Similarity:63/147 - (42%) Gaps:24/147 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    10 IKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFL 74
            |:||.|.|||:..:.|||.:.:.:         ...:|.........|:||.:  |:::.|:.|.
  Fly     8 IRYLAFLFNFLCAVLGIATIVVNV---------IAIDQIAPKDQLILGLYIAV--GSIVFLLSFF 61

Mouse    75 GCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRE 139
            ||.||::||.|:...:...:||:..:.|........|          |.:|:..||:.....|..
  Fly    62 GCFGAIKESICVTWAYATSMLVMLIVSIVMLFVFRMH----------FEEDSITKLKQAFAKQTN 116

Mouse   140 TLKAI---HMALDCCGI 153
            |..|:   .....||||
  Fly   117 TFDAMAEYQTQYQCCGI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd9NP_031683.1 Tetraspannin 9..219 CDD:278750 39/147 (27%)
CD9_LEL 109..191 CDD:239405 12/48 (25%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 39/147 (27%)
tetraspanin_LEL 93..174 CDD:239401 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.